KEGG   Xiphophorus maculatus (southern platyfish): 102227293Help
Entry
102227293         CDS       T02923                                 

Gene name
tk1
Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00240  Pyrimidine metabolism
xma00983  Drug metabolism - other enzymes
xma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    102227293 (tk1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102227293 (tk1)
Enzymes [BR:xma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     102227293 (tk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK Ribosomal_L40e AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 102227293
NCBI-ProteinID: XP_005810404
Ensembl: ENSXMAG00000000253
LinkDB All DBs
Position
5
AA seq 234 aa AA seqDB search
MDFYDSPVCPIRLQNSPRKSQGQIQIIFGPMFSGKSTELMRRVRRFQVAQYKCLIIKYAK
DIRYSDSGVATHDKITMEAVPATCLGDVRSAALKACVIGIDEGQFFPDTVEFCEEMANLG
KTVIVAALDGTFQRKPFGNILNLVPLAESVVKLHAVCMQCYKEAAYTKRLGAEKEVEVIG
GADKYQAVCRKCYGGLVVDKENNSSIRNETPLHVPMGKLADPNVPRKLFSPLHL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggacttctatgattcgccagtttgtccaatcaggctacaaaactcaccgaggaaatcc
caaggacagattcagattatatttgggccgatgttttcaggcaaaagcactgaactgatg
agaagagtgcgccgtttccaggtggcccagtacaaatgtttgatcatcaaatatgccaaa
gacatccggtattcagactcaggtgtggccacacatgacaaaatcaccatggaggccgtg
cctgccacctgcctaggagacgttcgctccgccgctctgaaggcctgcgtcattgggatt
gatgaaggacagttttttccagacaccgtggagttttgtgaggagatggccaatttaggg
aagacggtcatcgtggctgcgttggatgggaccttccagaggaagccttttggaaacatc
ctgaacctggttcctctggcagaaagtgtggtgaagctccacgccgtctgcatgcagtgt
tacaaagaagccgcctacaccaagaggctcggagcagagaaggaggtggaagtgatcggc
ggtgctgacaagtaccaggcggtgtgcagaaagtgctacggcggtctggtggtggacaaa
gagaacaactcctctatcaggaatgaaacgccgcttcacgtcccgatgggaaaactcgcc
gaccccaacgttccccggaaactgttctcccctctgcacctctga

DBGET integrated database retrieval system