KEGG   Xiphophorus maculatus (southern platyfish): 102231210Help
Entry
102231210         CDS       T02923                                 

Gene name
pcsk1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     102231210 (pcsk1)
Peptidases [BR:xma01002]
 Serine Peptidases
  Family S8: subtilisin family
   102231210 (pcsk1)
Chaperones and folding catalysts [BR:xma03110]
 Intramolecular chaperones
  Subtilisin family
   102231210 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 772 aa AA seqDB search
MEVRCRPAVMCCVFAVLCSALSRSQALSYADRQYLNEWAVEIPGGLSEAEAIAKELDYQL
VRQIGALENLFLFKHGSHPRRMRRGAEHITRQLSEDDRVLWAEQQYEKRRSKRAALRECR
DCSVDKLFDDPMWNQQWYLQDTRSSSSLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWN
HTDIYANYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNS
KVGGIRMLDGIVTDAIEASSIGFNPNHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQ
QGRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLAT
AYSSGDYTDQRITSSDLHDDCTQTHTGTSASAPLAAGIFALALEQNPDLTWRDLQHIVVW
TSEFDPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPAVWKHMPEKKQCIVRDDA
FQPRELKAAGEITIEIPTKACEGQENAIRSLEHVQVEASIEYTRRGDLHITLTSPAGTTT
VLLAERERDTSSNGFKNWDFMSVHTWGEDPAGTWTLKITDTSGRMENKGRILNWKLILHG
TSEKPEHMKKPRVYIPYNAVQNDRRGVEHMDDMMEEPTQPRPPQKTGAAEASPSVSEKEP
KSPSSGSPRRPSLALLRLLQTAFKQQATVSQRPGATARPLSARRKQQSRGFLPLPTKLPA
HKLYQALDLINKFSGPGDSLYSDYSDGFYNIKPYKHRNDRLLQALFEMLDDE
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgagatgccgtccagcggtgatgtgctgtgttttcgccgtcctctgctccgcg
ctgtcccgctcccaggcgctgtcttacgcggacaggcagtacctgaacgagtgggctgtg
gagatccccggcgggctgtccgaagccgaggccatcgccaaggagctggactaccagctg
gtccgacagatcggggccctggaaaacctcttcctgttcaaacatggcagccaccctcgc
agaatgagacgcggcgcggagcacatcaccaggcagctctcggaggatgaccgggtgttg
tgggcagagcagcagtacgagaagcgaaggagcaagcgggcggccctgagggaatgcagg
gactgctcagtggacaaactttttgacgaccccatgtggaaccagcagtggtacctgcaa
gacacgcggtcgtcgtcctcgttgccgaagctggacctgcacgtgatccccgtctggcag
aagggcatcacggggaagggagtggtcatcaccgtcctcgacgacggactggagtggaac
cacacagacatctatgccaattacgatccggcagccagctacgatttcaacgacaacgat
ccagatcctttccccagatacgactccaccaatgaaaacaagcatggcaccaggtgtgca
ggggagattgcaatgcaggctgacaacaacaaatgtggcgtcggagtggcgtacaactcc
aaggttggaggaattcgcatgctggatgggattgtgacggatgccatcgaggcgagctcc
attgggttcaaccccaaccatgtggacatctacagcgccagctgggggcccaatgacgac
ggcaagaccgtggagggtcctggccgcctggcccagaaagcatttgaatacggtattcag
cagggtcgcaatgggaaaggctccatcttcgtctgggcatcgggtaatggaggtcgccag
ggcgataactgtgactgcgacggctacacagacagcatctacaccatctcaatcagcagc
gcctcccagcagggcctgtccccgtggtacgccgagaagtgctcctccactctggctacg
gcgtacagcagcggagactacactgaccagaggattaccagctccgatcttcacgacgac
tgcactcagactcacactggaacctcggcttccgccccactggctgctgggatttttgcc
ctcgcactggagcaaaatccggatctcacgtggagggacctgcagcacattgtggtgtgg
acctcggagttcgacccgctggccaataacccgggctggaagaggaacggagcggggctg
atggtgaacagccgcttcggattcgggcttctcaacgccaaagcactggtggacctcgca
gacccagccgtgtggaaacacatgccggagaagaagcagtgcatcgtcagagacgacgct
tttcagccaagggagctgaaggcggcgggagagatcaccatagagattccaaccaaagcc
tgcgagggccaggagaacgccatccgctccctggagcacgtgcaggtggaggccagcatt
gaatacacccggagaggagacctgcacatcacccttacctcccccgcaggtacaaccact
gtgcttctggccgagagagaaagagacacgtcatccaacggcttcaaaaactgggacttt
atgtcggtgcacacctggggagaagaccctgctggtacttggacattgaagatcacagat
acttcggggcgaatggagaacaaggggcggatcttgaactggaagctgatactccacgga
acatcggaaaagccggaacacatgaagaaacctcgagtctacattccttacaacgccgtt
cagaatgaccggcgtggggtggagcacatggatgacatgatggaggaacccacgcagccc
cgcccccctcagaagaccggggctgcagaagcctctccttcagtctcagagaaggagccc
aaaagcccctcaagcggttccccacgccgcccttccctggccctgctacgtctccttcag
acggctttcaaacaacaggccaccgtgtcgcagcgtcccggggccacagcgaggcccctc
tctgcccggaggaagcagcaaagtcggggttttctccctcttcctacgaaactcccagct
cataagctgtaccaggctctggacttgatcaacaagtttagcgggccgggggacagcctc
tacagtgactacagcgacggcttctacaacatcaagccgtacaagcacagaaacgaccgg
ctgctgcaggccctgtttgaaatgctggatgacgagtag

DBGET integrated database retrieval system