KEGG   Xiphophorus maculatus (southern platyfish): 102232999Help
Entry
102232999         CDS       T02923                                 

Gene name
hdac7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102232999 (hdac7)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102232999 (hdac7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102232999
NCBI-ProteinID: XP_023187435
Ensembl: ENSXMAG00000004559
LinkDB All DBs
Position
1
AA seq 951 aa AA seqDB search
MDLRVGERGTPLHQPLLLTPFSSQGRSTFSQQQQLHQQIRFNMEQRRREQEHHEKHQELQ
QLMHKDRSQQSAVASSAVKQKLQEVILKKQKQAALERTNSNALNAHPVPYRKLGPDPNVP
AQPLVSSPPQPPSDGLEGTPLRRAASEPNLKVKNKLKDHLKTRKSPLTRKESAPPTIKHR
ASDVLDSSPSSSSTPVSGCSSPNDSLPNENGLLPSAGGPLHEAQKLLLRDGTLSNFTIQN
PSTLPTITLGLPVNPRAEVELSSLKVSHIPVVTAGGSPVFLPLSRDDQAGQMNPHLPVII
LEPSGLMHTLGVPGLDPVPLQFAPQLDRLSPGGVQAHKPLSRTRSEPLPQSPRALHNHLL
QQQHNAQLLERLKQQTHLGKLMSKSSEKPRLHQIPSEDMDSEDGGGASPTETSYQSRVRA
ESLREAEPTGSKAQEQINLQHALILNQSLLYEQQKQLQQMHQQMETLAVPVFRGGGPACG
PGVHRALSRTRSLPASTSLTPPENTLSLTPQDTVSKPRFTTGLVYDSQMLKHQCTCGDNS
SHPEHAGRIQSIWSRLQERGLRGQCESIRGRKANLEELQSVHTERHVLLYGTNPLNRLKL
DNRKLAGILSQRMFVMLPCGGVGVDNDTIWNESHTSTASRMAAGSVVELSFRVAKGELKN
GFAVVRPPGHHADPSNPMGFCYFNSVAIAAKQLQQKLNVSKILIVDWDVHHGNGTQEVFY
SDPSVLYISLHRYDDANFFPGSGSPTEVGSGAGEGFNVNIAWTGGLEPPMGDAEYLAAFR
SVVMPIAQEFSPDVVLVSAGFDAAEGNPAPLGGYKVSAKCFGFLTRQLMSLAGGRLILAL
EGGHDLTAICDASEACVSELLGIQDAMSEDVLLQKPNANAVRSLQTVIEIQSQYWQSVKA
HSGSVGRSYAAAQSKDCEETDAVNALASLSVGVISNKRLLDEPMDHESNSM
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggacctccgggtgggagagcgggggaccccgctgcaccagccactgctcctcacaccc
ttctcctcacaaggccgcagcaccttctcccagcagcagcagctgcatcagcaaatcagg
tttaacatggagcagaggagacgggagcaggagcaccatgagaaacatcaggaactgcaa
cagctaatgcacaaagacagaagccagcagagcgctgtagcgagttcggcggtgaaacag
aaactccaggaggtgattctcaagaagcagaaacaggcagcgcttgaaagaacaaactca
aacgccttgaatgcacatcctgtaccttacagaaagcttggtccagaccccaacgtcccc
gcccagcctctggtctcatctccaccacaacctccatctgacggcctggaggggacgccg
ctgcgcagagcagcatctgagcccaacctgaaggtgaagaacaagctgaaggaccacctg
aaaacacgaaagagtccactcacccgcaaggaaagcgccccgcccaccatcaagcaccga
gcatcggacgtgctagactcttcccccagcagcagcagcactccggtctctggctgtagt
tctcctaatgacagtctgcccaatgagaatggactgctgccctctgcaggcgggcctctg
catgaggctcagaagttgctgctcagagatgggaccttgtctaacttcaccatccagaat
ccatccactctgcccaccatcacactgggactgccagtcaaccccagggctgaggtggag
ctctcctcgctgaaggtcagccatattcccgtggtcactgccgggggctcgcctgtcttc
ctgccgctcagcagagacgaccaggcgggccagatgaacccacacctgcctgtcatcatc
ctggagccttctggactcatgcatactctgggtgtgccgggcctcgaccccgtccctttg
cagttcgcgccacagttagaccgtctgtctccagggggcgttcaggcccacaagccgctg
agcagaacccgctcggaaccccttcctcagagcccccgggccctccacaaccatctcctc
cagcagcagcacaacgcgcagctgctggagaggctcaagcagcagacgcacctgggaaag
ctgatgtccaagtccagcgagaagcccagactgcatcagatcccatctgaggatatggat
tctgaggatggcggtggagcttcacccacggagaccagctaccagagcagagtgcgggcg
gagtcactgagggaggcggagccaaccggatccaaagcccaagagcaaatcaacctacag
catgctctcatactcaaccagtcgttgctatatgaacagcagaagcagctgcagcagatg
catcagcagatggaaaccctggctgtgcctgtgttccgcggcggcgggccggcctgcggg
cctggcgttcatcgggcgctgtcgcgtacacgctcgttgccggcctccacctcgctcact
ccgcctgagaacaccctgagcctgacgccgcaggacactgtcagcaaaccccgcttcacc
accgggctggtttatgactctcagatgctaaaacaccaatgcacatgtggagacaacagc
agtcacccagagcatgctgggagaatacagagcatctggtcacgactgcaagagagaggc
ctgagagggcagtgtgagagtatccgcggtcggaaggccaacctagaggagctgcagtca
gtccacacggagcgccacgtgttgctttacggcacaaaccccctcaacaggctgaaactg
gacaaccgcaaactggctggaattctctcgcaaaggatgtttgtcatgttgccatgcggc
ggagtcggggtggacaatgacaccatctggaatgagtcacatacttccacagcatcacgc
atggcggcgggcagcgtcgttgagctgtcattcagggtggccaaaggagagctcaagaac
ggctttgctgtggtcagaccgccaggacatcacgccgacccctccaacccaatgggtttc
tgttattttaactctgttgccatagctgccaagcagctccagcagaagctcaatgtcagc
aagatcctcatcgtcgactgggatgttcaccatggtaacggcacccaggaggtgttctac
agcgaccccagcgttctgtacatttcacttcatcgctatgatgacgcaaacttcttccct
ggcagcggttcaccaacagaggttggttctggagccggtgagggcttcaatgtgaacata
gcctggaccggaggcttggagccacccatgggagatgctgagtatcttgctgcgttcagg
tctgtggtgatgcccatcgctcaggaattctctccagatgtggttttggtgtcggccggg
tttgacgcagctgagggaaaccctgctcctctgggcgggtacaaagtctctgccaagtgc
tttggcttcctgacccgccagctcatgtccctcgctggaggccgtctgattctggccctt
gagggaggtcatgacctcacagccatctgtgacgcctctgaagcctgcgtcagtgaacta
ctgggtatacaggatgcaatgtcagaggatgttctgctccaaaaacccaacgccaacgca
gtgcgctccctccagactgtgatagaaatacaaagtcagtactggcagagtgtgaaggcc
cacagcggatcggtgggcaggtcgtacgctgccgctcagagtaaggactgcgaggagacg
gacgccgtaaacgctttggcctcgctctctgtgggagtcatctccaacaagaggctcctg
gacgagccgatggatcacgaaagcaactccatgtag

DBGET integrated database retrieval system