KEGG   Xiphophorus maculatus (southern platyfish): 102234287Help
Entry
102234287         CDS       T02923                                 

Gene name
tufm
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Translation factors [BR:xma03012]
 Eukaryotic Type
  Elongation factors
   102234287 (tufm)
 Prokaryotic Type
   102234287 (tufm)
Mitochondrial biogenesis [BR:xma03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    102234287 (tufm)
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102234287 (tufm)
  Exosomal proteins of breast cancer cells
   102234287 (tufm)
  Exosomal proteins of colorectal cancer cells
   102234287 (tufm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 102234287
NCBI-ProteinID: XP_005807054
Ensembl: ENSXMAG00000011848
UniProt: M4ABN0
LinkDB All DBs
Position
16
AA seq 446 aa AA seqDB search
MAALVGLRACFSALQLTSPSLLHSSFKLCAVPLSRRTFAAEAKKTYSREKPHVNIGTIGH
VDHGKTTLTAAITKVLADAGGANYKKYEDIDNAPEEKARGITINASHVEYTTANRHYAHT
DCPGHADYVKNMITGTAQMDGCILVVAATDGQMPQTREHLLLARQIGVEHVVVFINKADA
VEDKEMLDLVEIEIRELLTEFGYDGENTPVVIGSALCALENKQPELGENAVMKLLEIVDS
YVPLPKRELVKPFLLPIEGVYSIPGRGTVVTGTLERGLIKKGDDCEFVGHSRSFKTVVTG
IEMFHKSLDRAEAGDNLGALVRGLKREDVRRGMVMCKPGSIMPHQKVKAQVYILSKEEGG
RHKPFVTNFMPVMFSFTWDMACRVTLPGDKEMVMPGEDASLTLTLRQPMVLEKGQRFTLR
DGNRTIGTGLVTEILTMTDEDQCNWG
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcttgtggggctgcgtgcctgtttctctgcccttcagcttacttcgccaagc
cttctgcacagctcgttcaaactctgtgctgtgcctctgagtcggcggacgttcgcagct
gaggccaagaagacgtacagcagagagaagccgcacgtgaacatcggaaccatcggccac
gtcgatcacggcaaaaccaccctcaccgcagccatcacaaaagtgctcgctgatgctggt
ggtgcaaattacaaaaaatatgaggacattgacaatgctccagaggaaaaggccagagga
attaccatcaacgcctctcatgtggagtacacgacagccaacagacattacgcccacaca
gactgccccggccacgctgattacgtcaagaacatgatcacgggcacagcccagatggac
ggctgcatcctggtggtggcggccaccgacggccagatgcctcagacgcgggagcacctc
ctgctggccaggcagatcggcgttgagcacgtggtggttttcatcaacaaggccgacgcc
gtggaggacaaggagatgctggacctggtggagatcgagatccgcgagttgctcacagag
ttcggctacgacggcgagaacacacccgttgtgatcggctctgccctctgcgccctggag
aacaagcagcctgaactgggagaaaacgcggtgatgaaactcctggagattgtggattcc
tacgttcctctgcccaaaagagagctggtaaagcctttcctcctgcccatcgaaggggtt
tattctatcccaggcagagggacggtcgtgaccgggacgttggagagaggcctgattaag
aaaggagacgactgtgagtttgtaggtcacagccgttccttcaagactgtggttacaggt
atcgagatgttccacaagtctctggaccgggccgaggccggagataacctgggcgctctg
gttcgaggcctgaagagggaagacgtgaggagagggatggtgatgtgtaagccgggctcc
atcatgccgcaccagaaggtcaaagcacaggtttatattctgagtaaggaggagggaggc
cgacacaagccgttcgtcaccaacttcatgcccgtcatgttttccttcacctgggacatg
gcctgtagggtcactctacctggagacaaggaaatggtgatgccaggagaggacgcgtcg
ttgacgctgacgcttcgccagcccatggtgctggagaaaggccagaggttcactctgaga
gacggaaacagaaccatcggtaccggcctggtcacagaaatcctgaccatgacagatgaa
gatcagtgcaactggggctga

DBGET integrated database retrieval system