KEGG   Xiphophorus maculatus (southern platyfish): 102234339Help
Entry
102234339         CDS       T02923                                 

Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xma00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102234339
Enzymes [BR:xma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102234339
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102234339
   HMT complexes
    COMPASS/SET1 complex
     102234339
    COMPASS/SET1 complex (yeast)
     102234339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 102234339
NCBI-ProteinID: XP_014330779
LinkDB All DBs
Position
16
AA seq 2168 aa AA seqDB search
MDPDSGTETQKAVSLQWESYKLVQDPAIRRVTQKVYRYDGVHFSVPDSGFPPVGELRDPR
PRRLWSRYTEISLPVPKFKLDEFYVGPIPLKEVTFARLNDNIKEPFLAEMCSKFGEVEEM
EILFHPKTRKHLGLARVLFTNTRGAKDTVKHLHNTSVMGNIIHAQLDIKGQQRQKYYDLI
VNGSYTPQTVPLGGKALTDSVQSQTPAQPQPDTSEIRRRYSSELAVLAAGVHALTSGSMT
PCSVETGFGEQRVDTPPSSLPGPYTPSSSASSQGGGGTPYSSRSGTPFSQDSGYSGSRHP
NYNAGSLSSGYPPQDMLPSSSSSSAVSSSVGGFKVSRYPDEQDPSLYHRGRPSYPPTTSY
RPNEPPGYAPYPNLGGPGSHMAHHSSMPPPPICNQYDQPPLPDRERSESAGRYAAAGVGS
RRSSYHHQQDSNSSSKYHSHHSHHHSDRRDDRGYRRDSVGSRSGDHGHQRHRNHHHSHNH
HSSRRRSSHDRDRDRDADYANSSDPRYNSNSYRSSSNSMSPPPSSYSAYASSKDPAPTPP
QDGSSRSAGSTLAEKAGSDKDHHGALPPPPPPPPPPLPPASVIAAAVAETLGTLDFNQDS
PAREDQWTKPKRRPTTPPAPPKTPPPSSPSQPTTAKSSSNSPSSASLPHHLSSSSSSPPP
PHRDSSPEPDSTNESLPFVYHSSSLDSRIEMLLKEQKAKFSFLASDEEDEEDRKEEKQRS
RVREGAERRSDAAKEQEHRGDNGENDHRKKGERDREGHRGRKRGKGEGRKSPTVLPAGTQ
PSENYSPHIVPPEEPPPPVGIDATEALQQDDPQAGSADPGVRTGAHTPPPFNGQSQASPH
SSGEDMEISDDDAEETTTITTVTTHQPTVASGSTPSSSQAAAAGLSQPADPSSSPPPISD
SSQHFGTSMHPPIPSYPPHLPPPPPPGYSLQPPPPPGIPPLPHMELHPEYPPPMPHHMYD
YATSMELMNQYSGGAPMSFQMQTHMLSRLHQMRLSSSNGTAGPSEAATGDYASYHLHSIP
PPHTHHPYMDQEGNGAGAHYDQDHRYMPPHMSYPYHEPHSTQIPPPPHHSIPPPHSGWPP
HVLPPHFQSYLPPPGYGTMLTGEGDEYSASGEALPMMAENPHEATVQMVLASLIQEMKNI
VQRDLNRKMVENVAFATFDEWWDRKETKAKPFQTMVRGVSALRDDEKKEEKVNRPREPLM
SLVDWAKSGGVEGFSLRGALRLPSFKVKRKEPQEFKEGDLKRPRPSTPPDEDDEAGRMPE
ADRHAADRDNKRRKKKPRSRKPWELDSEGEETSDGSSSEKEDEEVESEKESDDDGLSSDS
DDESLSSSSEGSSSSASSSSSSSEDEEEEEGELVESAGPDSMDESTMDSTTEKEDDRHIV
AGAVPKVDIKKGVSKEIKADIPAAPLSPLGPRPSSPNAFVPPLKKRRKTVSFSTDENDSK
PLLPAPSPTQPGSEAPPTADKPLDSPIALTPPPSCRPAHSIQLLPFASKPGEGNALIVPP
PSRNQDPEESKKTPLAPSPKSPGKRVASKDSLRPAAAPVMVCRTVQNLPLDHASMCRMAF
EEAPAAAPGNKRSRGRTRTPSVCHAVREDEEDEEDGEQRLRIREQVGASSLLQLAGADLS
VLADVALKMDPEAGDSEETETSDEAEEQKMEGDPFSLESLALMMSPGVVVVLLEHNYCKP
PALAAATVASGARKPTARQDASVLVSADLNSISGVLEAPEEVIGEAAPPRGDKGEYFSPV
GDLGDSDDNRQMAPVSPSPKRKNYVGKGLEVDQDKSEKRKRKDKENLEPHRTKKQKEPLG
KKQRKRKLEESDFEEDVDVEELESGELSSSDTENEVAEGMRKSERLFLQEAGVTSSQRWP
KPRPAPEPLLLKFENRSEFEQMTILYDIWNSGLDGEDLSFLKKTYEKLLQDDHSSDWLND
THWVNHTVTNLPNPRRKKKSADGQLREHVTGCARSEGYYAISRKEKDVYLDLDLPEQVIR
EVENVDSSGANRVLSERRSEQRRLLTVIGTTAVMDSDLLKLNQLKFRKKKLRFGRSRIHE
WGLFAMEPIAADEMVIEYVGQNIRQMVADNREKRYAQQGIGSSYLFRVDHDTIIDATKCG
NLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIAVNEEITYDYKFPLEENKIPCLCGT
ENCRGTLN
NT seq 6507 nt NT seq  +upstreamnt  +downstreamnt
atggatccagacagtgggaccgaaacacagaaagcagtcagcttgcagtgggaaagctac
aaactcgtccaggacccggccattcggcgggttacgcagaaggtttacagatatgacgga
gtgcatttcagtgttccagactccgggtttccccctgtgggagaactccgggaccctaga
ccccggagattatggtcgaggtatacagaaatatccctaccagtgccaaagttcaagctc
gatgagttctacgtgggccccatacccctcaaagaggtgaccttcgccaggctcaatgac
aacatcaaggagcctttcctggcagaaatgtgctccaagtttggtgaagtggaggagatg
gagatcctgtttcatcccaagaccaggaagcacttgggtctggccagggtgttgttcacc
aacacgagaggagcgaaggacacagtcaagcatttgcacaacacctctgtcatgggaaac
atcattcatgctcagctagatataaaaggtcaacagcggcagaagtactacgacctcata
gtaaacgggtcctacactcctcagacggtgccgctcggagggaaagctttgacggatagc
gttcagtctcagacgccggcgcagccgcagccggatacgtcggaaatccggcggaggtat
tccagtgagcttgcggttttggccgcaggagtccacgccctgacctcgggaagcatgacg
ccgtgttcagttgaaaccgggtttggcgaacagcgtgtcgacacgccgccttcgtcgtta
cccggtccatacacgccgagctcctctgcttcgtctcaggggggcggaggaacaccttac
agctccagatctgggactcctttctcacaagactcaggctactccggcagcaggcatccg
aactacaacgcaggctctttgagcagcggctatcctccccaggacatgttaccatcttca
tcttcatcgtccgcagtctcgtcttctgttggaggttttaaagtgtctcgttaccccgat
gaacaggacccatcactgtaccaccgaggtcgtccttcgtaccccccgaccacatcgtac
cgtcccaatgagccgccgggctacgcgccctaccccaacctcggaggtcccggctcacac
atggcgcatcactcctcaatgcctccgccgccgatttgcaaccagtacgaccagcctccg
ctgccggacagggagcggagcgaatcagcggggaggtatgcggccgcgggggttggttct
agaaggtcgtcctaccatcaccagcaagactcaaactcctcctcgaaataccattcccac
cactcccaccaccattcggaccgccgggacgaccggggttaccggcgagacagcgtgggc
tcccgctctggcgaccacggccaccagcggcaccgcaaccaccaccactctcacaaccac
cacagcagtcgcagaagaagcagccacgaccgggaccgcgaccgagacgccgactacgcc
aacagctccgaccccagatacaactccaactcctaccgatcgtcgtccaacagcatgtcg
ccgccgccgtcgtcttactcggcgtacgcctcttccaaagatcccgccccgaccccgccg
caggatggttcctcccgttcggctggttcaaccctggcagagaaagctgggtctgataag
gaccatcacggcgctttgcctcccccgccgcctcctccgccgccaccgctcccaccggcc
tccgttattgcagcagccgtcgccgagacgctgggaacgctagactttaaccaggacagt
ccggcccgcgaagaccagtggaccaaacccaaacgccgtcccaccacgccaccggccccg
cccaaaacgccaccaccatcctccccttcccaacctactaccgccaaatcttcttccaac
tctccctcctcggcctcccttcctcaccacctttcctcttcctccagctcccctccacct
cctcatcgcgactcctctccagagccagactccacaaacgagagtttgccgtttgtctac
cacagcagcagcctggactctcgaatcgagatgctcctgaaggaacaaaaggccaagttt
tccttcctcgcttctgacgaggaggacgaggaggacaggaaagaggagaagcagaggagc
agagttagagagggagcggagcgaagaagtgacgctgcgaaggagcaggagcacaggggg
gacaacggggagaacgatcacaggaagaaaggggaaagagacagagaaggacacagaggg
agaaaacggggaaaaggagaagggaggaagagtccgactgtcctacctgctgggacacaa
ccctccgaaaattattccccccacatcgtacctccagaggaacctccgccccccgttggc
atcgatgctactgaagctctgcagcaagacgatcctcaggctggttctgctgatccgggg
gtccggaccggagcgcacacgccgccgccgtttaacgggcagagccaggcgtctcctcat
tcttctggcgaagacatggagatctcagacgacgacgccgaggaaacgaccaccataacg
accgtcacgactcaccagccaacagtcgcctcaggatcaacaccgtcatcctcacaagcc
gccgccgccggactctcacagccggcagacccctcatcctctccgccccccatctctgat
tcctcacagcactttgggacgtcgatgcacccgccgattccttcctacccgccccattta
ccgccccctcctccacccggctactcccttcagccaccgcctccgcctgggattccacct
cttcctcacatggagctacaccccgagtatcctcccccgatgcctcaccacatgtacgat
tacgccacctccatggagctgatgaaccagtacagcggtggagccccgatgtcgttccaa
atgcaaacccacatgctaagccgcctgcatcagatgcgtttgtcgtcgtccaatggcacg
gcagggccgagcgaggctgcgactggagactacgcatcgtaccatcttcactctatcccg
ccgcctcacacgcaccacccctacatggaccaagagggcaatggggcgggggctcactat
gaccaggaccacagatacatgccaccccatatgtcatacccctaccatgaaccccacagc
actcaaataccaccacctccacaccacagcatcccacctccgcactctgggtggccgccg
cacgtcttaccgcctcacttccagtcctacttgccaccgcccggctacggcaccatgctg
actggggagggagacgagtacagcgcctctggggaggcattgcccatgatggcggagaat
ccgcatgaagcgacggttcagatggtgctggcctctttgatccaggagatgaagaacatc
gtgcagcgggacctgaaccgcaaaatggtggagaatgtcgccttcgccacttttgatgag
tggtgggacaggaaggagaccaaggccaagcctttccagacgatggttaggggagtgtct
gccttacgggacgatgaaaagaaagaggaaaaggtcaaccgtcctcgagagcctctgatg
tcacttgtagattgggcaaaaagtgggggcgtggaggggttttctcttcgtggagcgctg
cgattaccttcattcaaggtgaaaaggaaagaacctcaggagttcaaagagggagactta
aagaggcctcggccttcaactcctccagatgaagatgatgaagctgggagaatgccagag
gcagacaggcatgcagctgatcgggacaacaagaggaggaaaaagaagccaagaagtcgt
aaaccctgggagcttgacagtgaaggagaggaaacatccgacggctcatcgagcgagaag
gaggacgaagaagtggaaagtgaaaaggaatcagatgatgacggcctcagtagtgacagc
gatgatgagagcctgtcttcgtcctctgaaggttcttcctcttcggcgtcctcctcttca
tcctcttctgaggacgaggaggaggaggaaggggagctagtggaaagtgccggtccggac
tccatggatgagtcaacaatggacagcacaactgagaaagaggatgacaggcatattgtt
gcaggtgctgttccgaaggtcgacatcaaaaaaggtgtttctaaggaaatcaaggccgat
atcccggcggctcctttgtctccactcggccctcgcccttcgtctccaaacgctttcgtt
cctcctttgaagaaacgcaggaagactgtttccttctccacagacgagaacgacagcaaa
cccctgcttccagctccgtcgccaacgcaaccgggaagcgaggctccgcccaccgccgac
aagcctctggactcccccatcgctctcacgccgccgccttcctgccgacccgctcacagc
atccagctgcttcccttcgcctcgaaacccggcgaaggcaacgcgctcatcgtcccgccg
ccgagccggaaccaggaccccgaggagtccaagaagacgcccctggctccctccccgaaa
tcccccggcaagcgggtcgcgagcaaagactcactccgacccgccgccgctcctgtcatg
gtgtgccgcaccgttcagaacctgccgctggaccacgcctcgatgtgtcgcatggcgttc
gaggaagcccctgctgcggctccgggcaacaagcggtccagaggccggacccggacgccc
agcgtgtgtcacgccgtcagggaggatgaggaggacgaggaggacggcgagcagcggctg
aggatcagggagcaggtcggtgcgtccagccttctgcagctggccggcgcggacctgtcg
gtgctggcggacgtggcgctgaaaatggacccggaagctggggactcggaggagacggag
acgtcggacgaggctgaggagcagaagatggagggcgacccgttctccctggagtcgctg
gctctgatgatgagccccggcgtcgtcgtcgtacttctggagcacaactactgcaaacct
ccggcgctcgccgccgccaccgtggcgtccggcgccaggaaacccaccgccaggcaggac
gcgtccgttttggtgtcggcggacctcaactccatctctggagtcctggaggcgccagag
gaggttatcggggaggcagcgccgcccagaggagacaaaggcgaatacttctccccggtg
ggagatctgggcgactctgatgataacagacagatggcgccggtgtctccgtcaccaaag
aggaagaattacgtcggcaaaggcttggaggtcgaccaggacaagagcgagaagaggaag
aggaaagacaaggagaacctggagccacatcgcacgaaaaagcagaaggagccgctcggc
aagaagcaaaggaagaggaagctggaggaatcagactttgaggaagatgttgacgtggag
gagctggagtctggagaactttccagttcggacactgagaacgaagtagctgaaggaatg
aggaagagcgagcgtctctttctgcaggaggccggggtaacgtcgtcgcagcgctggccc
aaacctaggccggcgcctgagccgctacttttaaagtttgaaaaccgcagcgagtttgag
caaatgaccatcctgtatgacatctggaactcgggtctggacggggaagacttgagcttc
ctgaagaagacgtacgagaagctgctgcaggacgaccacagctctgactggctcaacgac
acccactgggtcaaccacactgtaaccaatttgccgaacccccggcgtaaaaagaagagc
gcggacggccagctgcgggagcatgtgacgggatgcgccaggagcgaaggctactacgcc
atcagccgcaaggagaaggacgtctacctggacctggacctgcctgagcaggtcatacgg
gaagtcgaaaacgtcgacagctcgggagctaatcgggtgctatcagagaggcgctcagag
cagcggcgtctcctcactgtcatcggaaccacagccgtcatggactctgacctacttaag
ctgaaccagcttaagttcagaaagaagaagctgcgatttgggcgcagcaggatccatgaa
tggggcctgtttgccatggagcccatcgccgccgacgagatggtcatcgagtacgtcggt
cagaacatcagacagatggtggccgacaaccgggagaagcggtacgctcagcaaggcatc
gggagcagctacctgttcagagtggaccacgacacaataatagacgccactaagtgtggc
aacctggcgcgcttcatcaaccactgctgcactccaaactgctacgctaaagtcatcacc
atagagtctcagaagaagatcgtgatctactccaagcagccgatcgccgttaacgaggag
atcacctacgactacaaattccccctggaggagaacaaaatcccctgcctgtgtggaacg
gagaactgccgcggaacgctcaactag

DBGET integrated database retrieval system