KEGG   Xiphophorus maculatus (southern platyfish): 102236214Help
Entry
102236214         CDS       T02923                                 

Gene name
hdac6
Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
xma  Xiphophorus maculatus (southern platyfish)
Brite
Enzymes [BR:xma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102236214 (hdac6)
Protein phosphatases and associated proteins [BR:xma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102236214 (hdac6)
Messenger RNA biogenesis [BR:xma03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102236214 (hdac6)
Membrane trafficking [BR:xma04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    102236214 (hdac6)
Chromosome and associated proteins [BR:xma03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102236214 (hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 102236214
NCBI-ProteinID: XP_023189766
LinkDB All DBs
Position
1
AA seq 1064 aa AA seqDB search
MASGSDPPGSGVKSVRRSPRLSPQAVGGVSLQEVKRRGRMENSKEEDGLSGRLKTLDLCS
RSAASGTGLVYSQIFTQHQNLWDTSHVESPDRVTAIMLELQRRELLSLCVTVEPREATEE
ELLLAHTKLYVDAMRATRTMTQTELQSLSDRYDSVYLHPESFQVCVTAVGSVLQLVDRVQ
TSDVRNGFAVIRPPGHHAQADQPNGFCVFNNMAVAARYAQKRHAVNRVLIVDWDVHHGQG
IQYLFQEDPSVLYFSIHRYEGGAFWPHLQESDCSFVGSGRAEGRNINLPWNKTGMSDADY
ITAFQQVLLPVAYEFQPQLVLVSAGFDAAAGDPKGEMCVRPQCFHILTHMLMSLAEGRLV
LALEGGYDLQATAEGVAACVTALLGGACPLLNPPTAPCDSALQSISGTVSALYPHWASLQ
VLAEPGPESPVITAAANHSSPTPASINTCVATTTGLAYDEKMMEHVNLWDRHHPEQPQRI
SKIFSKHQQQGLVARCHRIPARLATEEELAVCHSLQHIEQMKATAEMKPRDLHKLGNEFT
SIFFSNQSFQCAQLAAGSCFNAVDAILSGQLSNGVAIVRPPGHHAERDAPCGFCLFNTAA
LAARYAQKNSHDPQLRVLILDWDVHHGNGTQHMFEDDDSVLYISLHRYDNGTFFPFSEDA
ASDRVGVAKGAGFNVNVAWSGGRMGDSDYLAAFHHIVMPIAAEFNPGLVLVSAGFDAARG
DPLGGYQVTPEGYAHLTHLLMSLAGGRVLIILEGGYNLTSISDSMAMCTSVLLGDAPPSL
ATPFPPPHHCAVATIREVIRQHAPYWRSLRITVPESVQLALPSPKHRGKRSSEGKKSDKR
PLPPAEQEVATIQGMEQLTQGLASLDITQAPPTPQEPPTMEVKGDVESELENSQSAESMQ
TQNVTMATADSDPKGGEGSGEGAEPTPEGACGWSKPQVSLELTCSTEMGGDTLYVVDPLP
WCPHLDAVKPLPPSGVDVFQPCSDCGSHTENWICLTCYQVCCGRYVNEHMVTHGAVSEHP
VVLSFSDLSVWCYLCESYVHHQVLFEAKNAAHFAKFGEEVPPWC
NT seq 3195 nt NT seq  +upstreamnt  +downstreamnt
atggcttccggatcggatcctccgggatccggagtgaaatcagtcaggaggtctccacgc
ctgtcacctcaggctgtgggcggagtcagcctgcaggaggtgaagaggagaggacggatg
gagaatagcaaagaggaagacggtctgagtggacgtctaaaaacgctggatctgtgcagc
aggtctgcagccagcggaaccggactggtttactcccagatcttcacgcaacaccagaac
ctctgggataccagccatgtggagagtccagacagagtgacggccatcatgttggagctg
cagagaagggagctgctgagcctctgcgtcaccgtggagcccagagaagctacagaggag
gagctgttgctggctcacacgaagctttatgtggacgccatgagggcgactcggacgatg
acccagacggagctgcagagtctgtctgaccgatacgactctgtctacctccaccctgag
tccttccaggtgtgtgtgacggctgttggttcagtcctccagctggtggatcgggtccag
acctctgacgtcaggaacggattcgctgtcatcagacctccaggtcatcacgctcaggcc
gaccaacccaacggcttctgtgtgttcaacaacatggcggttgcggctcgctacgctcag
aaacgccacgccgtcaacagggttctgatcgtggactgggacgtccatcatggtcagggc
atccagtacctgttccaggaggatcccagtgtgctgtacttcagcatccacaggtatgag
ggcggagccttctggcctcacctgcaggagtcggactgcagctttgtgggcagcgggaga
gctgaagggaggaacatcaacctgccgtggaacaagacggggatgagcgacgctgattac
atcaccgccttccagcaggtgctgctgccggtggcctatgagttccagcctcagctggtt
ctggtctcagctggttttgatgctgcagccggagatccgaagggggagatgtgtgtccgc
cctcagtgtttccacattctgacccacatgttgatgagtttggctgaaggtcggctcgtt
ctcgctctggagggaggctatgaccttcaggcgacagcagagggcgtcgcagcctgcgtc
acagctctgctgggcggggcctgtcctcttctgaacccgcccactgctccctgtgacagc
gccttgcagtccatctctgggaccgtctcagcgctgtacccacactgggcctcgctgcag
gttctggctgaacccggtcctgagagtcctgtcatcacagcagcagcgaatcacagcagc
ccaacaccggcttccatcaacacttgtgttgccacgacaacaggtctggcttacgatgag
aagatgatggagcatgtgaacctgtgggacaggcatcaccctgaacagcctcagaggatt
tctaagatcttctccaaacatcagcagcagggattggtcgcccgttgccatcggataccc
gcccgcctggcgacagaggaggagctggccgtgtgtcacagcctgcagcacatcgagcag
atgaaggcgacggcggagatgaaaccccgcgaccttcacaaactgggaaacgagttcacc
tccatcttcttcagcaaccagagcttccagtgcgcccagttggctgctggaagctgcttc
aacgccgtggacgccatcctgagtggccagctgagtaacggcgtggccatcgtccgccct
ccgggtcaccacgctgagagagatgctccctgcggtttctgtctcttcaacaccgctgct
ctcgccgctcgctacgcccagaaaaactcccatgatcctcagctgcgagtgctgatcctt
gactgggatgttcaccatggcaacgggacgcagcacatgtttgaagacgacgacagcgtt
ctgtacatctctctccatcgctatgacaacgggacattcttccccttctcagaggacgcc
gcctccgacagggtgggcgtggccaagggggcgggctttaacgtgaacgtagcgtggagt
ggcgggcgaatgggcgactctgattacctggcagcgtttcatcacattgtcatgccgatc
gctgccgagtttaaccccggactggttttggtgtcggccgggtttgacgcggcccgggga
gatccgctgggcgggtaccaggtgactcctgagggatacgcccacctcacacacctgctg
atgtcactggctggggggcgtgtcctcatcatcctggagggcggttataacctgacgtcc
atctctgactctatggcgatgtgcaccagcgtgttgctaggagacgctcccccctcactg
gccacacctttccctcctccccatcactgtgcagtggcaacaatcagggaagtcatccga
cagcacgccccctactggcgctccctgaggattaccgttccagagtcggtgcagttggcc
ctcccctccccaaagcatcgtgggaaacgtagttctgaaggcaagaagtcagacaaacgg
ccactgccccctgctgaacaggaggttgctacgatacagggtatggagcagctcactcag
ggattggccagtctagatatcactcaagccccgcccaccccacaggaaccgcccacaatg
gaggtcaaaggtgatgtggagtctgagttggagaacagccaatcagcagagagcatgcag
actcagaatgttaccatggcaacagcagactcagaccccaagggaggagaggggtcaggc
gaaggggcagagcctacgccagagggagcctgtggttggtcgaagcctcaggtgtctctg
gagctgacgtgcagcactgagatgggcggagacactctgtacgtagtggaccctctgccc
tggtgtcctcacctggatgccgttaagcccctccctccctcaggtgttgacgtcttccag
ccgtgcagtgactgcggttctcacacggagaactggatctgcctcacgtgctatcaggtg
tgctgcggtcgctacgttaatgagcacatggtgactcacggcgccgtgtcagagcaccct
gtggtgctcagcttctctgatttgtccgtttggtgctacctgtgtgagtcctacgtccac
caccaggttctgttcgaagccaagaacgccgctcacttcgccaagtttggagaggaagtt
cctccctggtgctga

DBGET integrated database retrieval system