KEGG   Xiphophorus maculatus (southern platyfish): 102238393Help
Entry
102238393         CDS       T02923                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12-like
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
xma  Xiphophorus maculatus (southern platyfish)
Pathway
xma04010  MAPK signaling pathway
xma04371  Apelin signaling pathway
xma04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xma00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    102238393
   04371 Apelin signaling pathway
    102238393
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102238393
Exosome [BR:xma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102238393
  Exosomal proteins of colorectal cancer cells
   102238393
GTP-binding proteins [BR:xma04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    102238393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 102238393
NCBI-ProteinID: XP_005802404
Ensembl: ENSXMAG00000003991
LinkDB All DBs
Position
6
AA seq 72 aa AA seqDB search
MSSKAPSANNLNQARQVVQQLRLEARIDRIKISKASADIVKYCSEHQKTDPLIAGIPASE
NPFKEKKSCTLL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctaaagctccgagtgccaataacctgaaccaggcccggcaggtggtacagcag
ctgagactagaggcgagaattgacaggataaagatctccaaagcctccgcagacattgtg
aagtactgcagcgagcaccagaaaaccgaccccctcatcgcgggcatccctgcttcagaa
aaccccttcaaggagaagaagtcctgcactttattgtag

DBGET integrated database retrieval system