KEGG   Xenorhabdus nematophila ATCC 19061: XNC1_0297Help
Entry
XNC1_0297         CDS       T01274                                 

Gene name
tufB
Definition
(GenBank) putative protein chain elongation factor EF-Tu; GTP-binding factor (duplicate of tufA)
  KO
K02358  
elongation factor Tu
Organism
xne  Xenorhabdus nematophila ATCC 19061
Brite
Translation factors [BR:xne03012]
 Eukaryotic Type
  Elongation factors
   XNC1_0297 (tufB)
 Prokaryotic Type
   XNC1_0297 (tufB)
Mitochondrial biogenesis [BR:xne03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    XNC1_0297 (tufB)
Exosome [BR:xne04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   XNC1_0297 (tufB)
  Exosomal proteins of breast cancer cells
   XNC1_0297 (tufB)
  Exosomal proteins of colorectal cancer cells
   XNC1_0297 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
258325..259509
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERSKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAVLVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIIRGSALKALE
GEAEWEAKIIELAEALDSYIPEPERDIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
DEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMI
VSLIHPIAMDEGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgttcaaaaccgcacgttaacgttggtactatcggccac
gttgaccacggtaaaactaccctgactgctgcaatcaccaccgttctggcaaaaacctac
ggcggtaacgcgcgtgcatttgaccagatcgataacgcgccagaagaaaaagcgcgtggt
atcaccatttctacttctcacgtagaatatgataccccaactcgccactacgcacacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcacgggtgcggcacagatggat
ggcgcggttctggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgctgggccgtcaggtaggcgttccatacatcatcgtgttcctgaacaaatgtgacatg
gttgatgatgaagagctgctggaactggtagaaatggaagtccgtgagctgctgtctcag
tacgatttcccaggcgacgacacgccaatcatccgtggttctgctctgaaagcgctggaa
ggcgaagcagagtgggaagcgaaaatcatcgaactggctgaagcactggattcttacatc
ccagaaccagagcgtgacattgacaagccattcctgctgccaatcgaagacgtcttctcc
atctccggccgtggtactgtagttaccggtcgtgttgagcgtggtatcgttaaagtgggc
gacgaagttgaaatcgtgggtatcaaagaaaccaccaaaacaacttgtaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggcgagaacgttggtgttctgctgcgt
ggtactaagcgtgacgaaatcgaacgaggtcaggtattggctaaacccggttcaattaag
ccacacacccagttcgaatctgaagtgtatatcctgagtaaagatgaaggtggccgtcat
actccattcttcaaaggttaccgtccacagttctacttccgtacaactgacgtaaccggt
actatcgaactgccagaaggcgttgagatggtcatgccaggtgacaacatcaacatgatc
gttagcctgattcatccaatcgcaatggacgaaggtctgcgtttcgcaatccgtgaaggc
ggccgtactgtaggtgctggtgttgttgctaaagttattgcttaa

DBGET integrated database retrieval system