KEGG   Xenorhabdus nematophila AN6/1: XNC2_2411Help
Entry
XNC2_2411         CDS       T03752                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xnm  Xenorhabdus nematophila AN6/1
Pathway
xnm00010  Glycolysis / Gluconeogenesis
xnm01100  Metabolic pathways
xnm01110  Biosynthesis of secondary metabolites
xnm01120  Microbial metabolism in diverse environments
xnm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xnm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XNC2_2411
Enzymes [BR:xnm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     XNC2_2411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CEK23405
UniProt: A0A0R4FN00
LinkDB All DBs
Position
I:2458574..2459455
Genome map
AA seq 293 aa AA seqDB search
MLNKIFSLPVVEQISPYISQRNIDDFPLIVVSHPKARGVVSIQGAHLITWQPSGEKPVLW
VSEKTAFSTGTAIRGGIPICWPWFGPSATPSHGFARILPWELKAHTENENGVMLTFTLQD
NASTHQLWPHEFTLIARFKLGETCEIELESHGEYQAIGALHSYFNISDINQIRVSGLGGH
FIDSVIDREQYVHENLLFKGRTDRIYTEPEDFSLLRDPQWKRTIEIHHYHHSDVVCWNPG
ATLSSSMKDMSHEGYKNMACIETARINKPLHAKNGKPDRLSVVILCRKITDIG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctgaataaaattttctcattaccggttgtagaacaaatctccccttatatcagccaa
cgaaatattgatgattttccattgattgttgtttctcatcctaaagcacgtggcgttgtc
agtattcaaggcgcacatttgatcacatggcagcctagtggtgaaaaaccggtgttatgg
gtaagcgaaaaaacagcatttagcactggaacagccattcgtgggggtatccccatctgt
tggccctggtttgggccgtctgccactcccagtcacggatttgcccgaatattgccctgg
gaactcaaagcacatactgaaaatgagaacggggttatgctgacttttacactgcaagat
aacgcctctacccatcaattatggccccatgagttcacactcattgcgcgttttaaattg
ggagaaacctgcgaaatagaattagaatctcacggtgaatatcaagccatcggcgccctt
cactcttatttcaacatcagtgacatcaaccagatacgggtcagtggtctcggtggtcat
tttattgatagcgttattgatagagaacagtatgttcatgaaaatttactcttcaaagga
cgaacagatcgcatttatacggagccagaagattttagcctgctcagagatccacaatgg
aaaaggacgattgaaatacaccattatcaccatagcgatgtcgtatgctggaaccctggt
gccacgctttccagtagtatgaaagacatgagtcatgaaggctataaaaatatggcttgc
attgaaactgcacggatcaataagccattacacgctaaaaatggcaagcctgacagactt
tctgttgttattctctgtcgaaaaatcactgatattggctaa

DBGET integrated database retrieval system