KEGG   Xanthomonas oryzae pv. oryzae KACC 10331: XOO3729Help
Entry
XOO3729           CDS       T00235                                 

Gene name
badH
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xoo  Xanthomonas oryzae pv. oryzae KACC 10331
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xoo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOO3729 (badH)
   00053 Ascorbate and aldarate metabolism
    XOO3729 (badH)
   00620 Pyruvate metabolism
    XOO3729 (badH)
  Lipid metabolism
   00071 Fatty acid degradation
    XOO3729 (badH)
   00561 Glycerolipid metabolism
    XOO3729 (badH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOO3729 (badH)
   00310 Lysine degradation
    XOO3729 (badH)
   00330 Arginine and proline metabolism
    XOO3729 (badH)
   00340 Histidine metabolism
    XOO3729 (badH)
   00380 Tryptophan metabolism
    XOO3729 (badH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XOO3729 (badH)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XOO3729 (badH)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XOO3729 (badH)
Enzymes [BR:xoo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XOO3729 (badH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3984106..3985575
Genome map
AA seq 489 aa AA seqDB search
MEAVSETLRGIAARGPLGLFIDGQWSASTGDRHVDVIAQHTQEPLLRYTEPSHADTEAAI
AAARNAFDNGPWPQLSPQERSVLLKRVAEQLRARMPELAEAWTGQVDATIGFSKRASQQA
PNLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWKAPLVLLCYKVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVGEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARVGLKLGGKSAAIVLEDADSAKVLPTLVPYSMPIAGQVCFSLT
RMLVPAQRRDEILQAYCAALSAVKLGDPFAADTGMGPLALGRQLERVRSYIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEFTPDMTIARGEIFGPVVSFIDYHDEADLIAKANAGD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMRVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccgtatccgaaacgctgcgcgggatcgccgcgcgtggtcctctgggcttgttc
atcgatggacaatggagcgcaagcacgggagatcgccatgtcgatgtgatcgcgcagcat
acccaagaaccgctgctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaacgcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcgtgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcgacgccaccatcggcttcagcaagcgggcgtcgcagcaggcg
ccgaatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaaggcgccgctggtcttgctgtgctacaaggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggt
cgcgaggtgggcgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcgggtcggc
ctgaaactgggcggcaaatcggcggcgatcgtgctggaggatgccgacagcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcatgctggtgccggcacagcgccgcgatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtttgccgccgataccggcatgggaccgttggcgctg
ggccgccagctcgaacgcgtgcggtcctatattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaattcacaccggacatgaccattgcgcgcggggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tacggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcatcgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgcgggtagacatcagcatgccgttc
ggcggcttcaagcactcgggcatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system