KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_00654Help
Entry
PXO_00654         CDS       T00763                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xop00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PXO_00654
Enzymes [BR:xop01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PXO_00654
Transporters [BR:xop02000]
 Other Transporters
  Pores ion channels [TC:1]
   PXO_00654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2273282..2273734
Genome map
AA seq 150 aa AA seqDB search
MLTEAAATALQLADLHPQATLAPAPGTPERAAYYTWMFFCANTLQPASRAWFYPSEPAGA
EHAEAAQVQARRKLEAAWTQVAAHLQVHGPYLLGHTLSAADFMLTMLMRWSRNMPRPTDT
WPALQAHATLMKARPAFQETYRREGLTDWT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtgctcaccgaggctgcggccaccgcgctgcagctggccgatctgcatccacaggcgacg
ctggcacccgcgcccggcacacccgaacgcgcggcgtactacacgtggatgttcttctgc
gccaataccttgcagccggcatcccgcgcctggttctatccgagcgaaccggctggtgcc
gagcatgccgaggctgcacaggtgcaagcccgccgcaaactcgaagcggcctggacccag
gtcgctgcgcatctgcaggtccatggcccctatctgctgggacacaccttgtcggcggcc
gatttcatgttgaccatgctgatgcgctggtcgcgcaacatgccacgcccgaccgatacc
tggccggcgctgcaggcgcatgcaacgctgatgaaggcgcgcccagcgttccaggaaacc
tatcgccgggaaggcctgaccgactggacctga

DBGET integrated database retrieval system