KEGG   Xanthomonas oryzae pv. oryzae PXO99A: PXO_04473Help
Entry
PXO_04473         CDS       T00763                                 

Definition
(GenBank) angiotensin-converting enzyme, testis-specific isoform (ACE-T) (Dipeptidyl carboxypeptidase I)(Kininase II)
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xop  Xanthomonas oryzae pv. oryzae PXO99A
Brite
Enzymes [BR:xop01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PXO_04473
Peptidases [BR:xop01002]
 Metallo Peptidases
  Family M2
   PXO_04473
Exosome [BR:xop04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PXO_04473
CD molecules [BR:xop04090]
 Proteins
  PXO_04473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1289446..1291464)
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAVGTLSLSACRRDAAPPAKPVATKTAPAESADQFVARISAQYKAAYPE
TTAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSRQYAGTPMSADSARALQLLKLM
SALPAPRDAAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTARPMRKDYQRFVELANEGARGFGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYVQLQCYARGKLDTQYGKDKGEVPGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLTAVLARNTGGVGGATARFNAEHEAQLRTAKQMTERAQEFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEANQNIGADVRTKMCIQPTEEDFT
TIYHELGHLYYDLAYKPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQRTGR
EALINWQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVSA
RGEDFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKSLCQAAGHQGPLYECSFYRNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSEWLKQQNQGQMCGWQAAAAA
PASTTTAPAAPR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcgttggctgtggctgtcggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccgccggccaaacccgtcgcgaccaagaccgcgccggcg
gagagcgccgaccagttcgttgcgcgcatcagcgcccaatacaaggcggcctatccggaa
accaccgccgcgcagtggctgtcgtcgacctatatcaacggcgattcgcaattgctcgcg
gccaaggccaacgagcgctcgctggcgcagctggatcgctggatcgaacaatccaggcag
tacgccggcacaccgatgtcagccgacagcgcgcgcgcgctgcagttgctgaaattgatg
agcgccctgcccgcaccgcgcgatgcggccaaactcgccgaactcacccgcatcgccgcc
aagatggaaggcgactacggcgccggcagttactgcgtgggcgaaggcgaacagcgccgc
tgccgccagctcggcgaactggaacaagtattggccagcagccgcgactacaacgaacaa
ctcgacgcctggcagggctggcacagcaccgcacggccgatgcgcaaggattaccaacgc
ttcgtcgagctcgccaacgaaggcgcgcgcggattcggcttcgccgacgtcggggtgttg
tggcgcagtggctacgacatgccgccggcgcaactggccagcgaaaccgaccgcctgtgg
gaacaggtcaaaccgctgtacgtgcagttgcagtgctatgcgcgcggcaaactcgatacg
caatacggcaaggacaagggcgaggtgcctggcggtctgctgcctgcacatctgatgggc
aatatgtggcagcaggactggagcaatctgtgggatctgctgcagccctaccccggggcc
ggcgatctggacattacctccgcgctggaaaaacagtaccagggcaacctcaccgcagtg
ctggcacgcaacaccggtggcgttggtggcgcgaccgcacgcttcaacgccgagcacgaa
gcgcagctgcgcaccgccaagcagatgaccgagcgcgcgcaggagttctacacatcgctg
ggcatgcccaagctgccggacacctattggcagcgctcgcagttcatcaagccgctggac
cgcgatgtggtgtgccacgccagcgcctgggatatgaacatgggtggcgaggcgaaccag
aacatcggcgcggacgtgcgcaccaagatgtgcatccaaccgaccgaagaagacttcacc
accatctaccacgagctcggccacctctattacgacctggcctacaagcccttgccgccg
ctgtttcagaacggcgccaacgatgggtttcacgaggcgatcggcgacaccatcgtgctg
gcgatgacgcccaagtacctgcagtcgatcggcatggtgggcgagcaacggaccggccgc
gaggcgttgatcaattggcagatgcgcatggcgctgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgatggctccatcacgcccgagcat
tacaaccaggcctggtgggaactgaaagcaaagtaccagggcgtggcgccggtgagcgcg
cgcggcgaagacttcttcgaccctggcgccaagtaccacgtgccgggcaacacgccgtac
acgcgctattttctggcgcatatcctgcaattccagttctacaaaagcctgtgccaggcc
gctggccatcagggcccgctttacgaatgcagcttctaccgcaacaaggatgccgggcag
aagttctggtcgatgctgcaacgtggttccagccaaccctggcaaaccacactgaaggaa
ctcaccggcaacgacaaactcgatgccggcccgatgctggaatatttcgcgccaatgagc
gaatggctgaagcagcagaatcaggggcagatgtgtgggtggcaggcagcggctgccgct
ccagctagcacgacaactgcgcctgctgcgccgcgctga

DBGET integrated database retrieval system