KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_0933Help
Entry
XOC_0933          CDS       T01873                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XOC_0933
   00053 Ascorbate and aldarate metabolism
    XOC_0933
   00620 Pyruvate metabolism
    XOC_0933
  Lipid metabolism
   00071 Fatty acid degradation
    XOC_0933
   00561 Glycerolipid metabolism
    XOC_0933
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    XOC_0933
   00310 Lysine degradation
    XOC_0933
   00330 Arginine and proline metabolism
    XOC_0933
   00340 Histidine metabolism
    XOC_0933
   00380 Tryptophan metabolism
    XOC_0933
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    XOC_0933
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    XOC_0933
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XOC_0933
Enzymes [BR:xor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     XOC_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(939469..940938)
Genome map
AA seq 489 aa AA seqDB search
MEALSETLRGIPARGPLGLFIDGQWRASTGDRHIDVIAPHTQEPRLRYTEPSHADTEAAI
AAARKAFDNGPWPQLSPQERSVLLKRVAEQLRARMPELAEAWTGQVGTTIGFSKRASQQA
PDLFDYYGDLIATHAFVQPRVRPNGGRVHVVQEPVGVVAAITPWNAPLILLCYTVAAALA
AGCTVVAKPSPETPIDAYILAECISAAGVPAGVFNLVPAGREVDEQLIRHPQVDKVSFTG
STQAGRLIGIACAERLARIGLELGGKSAVIVLEDADIAKVLPTLVPYSMPIAGQVCFSLT
RVLVPAQRRDEILQAYCAALSAVKLGDPCAADTGMGLLALGRQLERVRSHIAKGSAEGAR
LVMGGGRPAHLPRGFFVEPTVFSEVTPDMTIAREEIFGPVVSFIDYHDEADLIAKANAGD
YGLHGTIYSEDAERAYRIARRVRSGSHAINGMWVDISMPFGGFKHSGIGREGGIEGLHAF
LETKTVYLS
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaagccttatccgaaacgctgcgcgggatccccgcgcgtggtcctctgggcttgttc
atcgacggacaatggcgcgcaagcacgggggatcgccatatcgatgtgatcgcgccgcat
acccaagaaccgcggctgcgctacaccgaaccttcgcacgccgataccgaagcggccatc
gctgctgcgcgcaaggcgttcgacaacggcccctggccgcagctctcgccgcaggaacgc
agcgtgctgctcaagcgggtggccgaacagttgcgcgcgcgcatgccggaactggccgaa
gcatggacgggtcaggtcggcaccaccatcggcttcagcaagcgggcgtcgcagcaggcg
ccggatttgttcgactactacggcgacctgattgccacgcatgccttcgtccaaccgcgt
gtgcgcccgaacggtggccgcgtgcatgtggtgcaggagccggtcggtgtggttgccgca
atcacgccctggaacgcgccgctgatcttgctgtgctacacggtcgccgccgcgctggca
gccggctgcacggtggtggccaagccatcgccggaaacgccgatcgacgcctatatcctg
gccgagtgcatcagcgctgccggcgtgccggccggcgtgttcaatctggtcccggccggc
cgcgaggtggacgagcaattgatccgccatccgcaggtggacaaggtcagctttactggc
tctacccaggcgggacgcttgatcggcatcgcctgcgccgagcgcctggcgcggatcggc
ctggaactgggcggcaaatcggcggtgatcgtgctggaggatgccgacatcgccaaagtg
ctgcccaccttggtgccctactccatgccgatcgccgggcaggtgtgcttctcgttgacg
cgcgtgctggtgccggcacagcgccgcgatgaaatcctgcaggcgtattgcgcggcattg
agcgcagtgaaactaggcgacccgtgtgccgccgataccggcatgggactgttggcgctg
ggccgccagctcgaacgcgtgcggtcccacattgcaaaaggcagtgccgagggcgcgcgc
ctggtcatgggcggtggccgcccggcgcacttgccgcgcggcttctttgtcgaaccgacg
gtgttctccgaagtcacaccggacatgaccattgcgcgcgaggaaatcttcggaccggtg
gtcagcttcatcgattaccacgacgaagccgacctcatcgccaaggccaatgccggcgac
tacggtttgcacggcaccatctacagcgaagatgccgaacgcgcctaccgcattgcgcgc
cgcgtgcgcagtggcagccatgcgatcaacgggatgtgggtagacatcagcatgccgttc
ggcggcttcaagcactcgggcatcggccgcgagggcggtatcgaaggtctgcatgccttc
ctcgaaaccaagaccgtgtatctgagctag

DBGET integrated database retrieval system