KEGG   Xanthomonas oryzae pv. oryzicola BLS256: XOC_3018Help
Entry
XOC_3018          CDS       T01873                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
xor  Xanthomonas oryzae pv. oryzicola BLS256
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:xor00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XOC_3018
Enzymes [BR:xor01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     XOC_3018
Transporters [BR:xor02000]
 Other Transporters
  Pores ion channels [TC:1]
   XOC_3018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3077048..3077527)
Genome map
AA seq 159 aa AA seqDB search
MPTLVLDGHVLTEAAATALQLADLHPQATLAPAPGTPERAAYYTWMFFCANTLQPASRAW
FYPSEPAGAEHAEAAQLQARRKLEAAWTQVAARLQVRGPYLPGHTLSAADFMLTMLMCWS
RNMPRPTDTWPALQAHATLMKARPAFQETYRREGLTDWT
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacgctggtactggatgggcacgtgctcaccgaggctgcggccaccgcgctgcag
ctggccgatctgcatccacaggcgacgctggcacccgcgcccggcacacccgaacgcgcg
gcgtactacacgtggatgttcttctgcgccaataccttgcagccggcatcccgcgcctgg
ttctacccgagcgaaccggctggtgccgagcatgccgaggctgcacagctgcaagcccgc
cgcaaactcgaagcggcctggacccaggtcgccgcgcgtctgcaggttcgtggcccctat
ctgccgggacacaccttgtcggcggccgatttcatgttgaccatgctgatgtgctggtcg
cgcaacatgccacgcccgaccgatacctggccggcgctgcaggcgcatgcaacgctgatg
aaggcgcgcccagcgttccaggaaacctatcgccgggaaggcctgaccgactggacctga

DBGET integrated database retrieval system