KEGG   Xanthomonas perforans: BJD13_10575Help
Entry
BJD13_10575       CDS       T04778                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xpe  Xanthomonas perforans
Brite
Enzymes [BR:xpe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BJD13_10575
Peptidases [BR:xpe01002]
 Metallo Peptidases
  Family M2
   BJD13_10575
Exosome [BR:xpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BJD13_10575
CD molecules [BR:xpe04090]
 Proteins
  BJD13_10575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2018044..2020062
Genome map
AA seq 672 aa AA seqDB search
MNPRLLLLALAVAAGTLSLSACRRDAAPPDTPVASKTALAESADQFVARISAEYKAAYPE
ITAAQWLSSTYINGDSQLLAAKANERSLAQLDRWIEQSKQYAGTPMSADSARALQLLKLM
SALPAPRDPAKLAELTRIAAKMEGDYGAGSYCVGEGEQRRCRQLGELEQVLASSRDYNEQ
LDAWQGWHSTAQPMRKDYQRFVELANEGARGLGFADVGVLWRSGYDMPPAQLASETDRLW
EQVKPLYAQLQCYARGKLDTQYGKDKGEVAGGLLPAHLMGNMWQQDWSNLWDLLQPYPGA
GDLDITSALEKQYQGNLSAVLARNTGGDGGAAARFNAEREAQLRTAKQMTERAQDFYTSL
GMPKLPDTYWQRSQFIKPLDRDVVCHASAWDMNMGGEPNQNIGADVRTKMCIKPTEEDFT
TIYHELGHIYYDLAYNPLPPLFQNGANDGFHEAIGDTIVLAMTPKYLQSIGMVGEQQTGR
ESLINSQMRMALSKVAFLPFGLMIDRWRWGVFDGSITPEHYNQAWWELKAKYQGVAPVGT
RGEEFFDPGAKYHVPGNTPYTRYFLAHILQFQFYKGLCQAAGHQGPLYECSFYGNKDAGQ
KFWSMLQRGSSQPWQTTLKELTGNDKLDAGPMLEYFAPMSEWLKQQNQGQMCGWQATAAA
PATTTTAPATAR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctcgtttgctgttgctggcgttggctgtggctgccggcaccctgagcttgtcg
gcctgccgccgggatgcggcaccaccggacacacctgtggcgagcaagaccgcgctggcc
gaaagcgccgaccagttcgttgcgcgcatcagcgccgaatacaaggcggcctatccggaa
atcactgcggcgcagtggctgtcgtcgacctacatcaacggcgattcgcagttgctggcg
gccaaggccaacgaacgctcgctggcgcagctggaccggtggatcgaacaatccaagcag
tacgccggcacaccgatgtcggccgacagtgcgcgtgcgctgcaattgctgaaattgatg
agtgccctgcccgcaccgcgcgacccggccaagctggccgaactcacccgcatcgccgcc
aagatggaaggcgattacggcgcgggcagctactgcgtgggcgaaggcgagcagcgccgc
tgccgccagctcggcgagttggagcaagtgctggccagcagccgcgactacaacgaacaa
ctcgacgcctggcagggctggcacagcactgcgcagcccatgcgcaaggactaccaacgc
ttcgtcgaactggccaacgagggcgcacgcgggctgggtttcgccgacgtcggggtgcta
tggcgcagcggctacgacatgccgccggcgcaactggccagcgaaaccgaccgtctgtgg
gaacaggtcaaaccgttgtatgcgcagctgcagtgctatgcgcgcggcaaactcgatacg
caatacggcaaggacaagggcgaggtcgccggcggcctgttgccggcacacctgatgggc
aatatgtggcagcaggactggagcaacctgtgggatctgctgcagccctaccctggcgcc
ggcgatctggacatcacctccgcgctggaaaagcagtaccagggcaacctcagcgcagtg
ctggcgcgcaacaccggcggcgatggtggcgcggccgcacgcttcaacgccgaacgcgag
gcgcagctgcgtaccgccaagcagatgaccgaacgcgcgcaggatttctacacatcgctg
ggcatgcccaagctgccggacacgtattggcagcgctcgcagttcatcaagccgctggac
cgcgatgtggtgtgccacgccagcgcctgggacatgaacatgggcggcgagccgaaccag
aacatcggcgcggacgtgcgcaccaagatgtgcatcaagccgaccgaagaagacttcacc
accatctaccacgagctgggccacatctattacgacctggcttataacccgttgccgccg
ctgtttcagaacggcgccaacgatggcttccacgaagcgatcggcgacaccatcgtgctg
gcgatgacgcccaagtatctgcagtcgatcggcatggtgggcgagcaacagaccggccgc
gagtcgttgatcaattcgcagatgcgcatggcactgagcaaggtggcgttcctgccgttc
ggtttgatgatcgaccgctggcgctggggcgtgttcgacggctccatcacgcccgagcat
tacaaccaggcctggtgggaactgaaagccaagtaccagggcgtggcgccggtcggcacg
cgcggcgaagaattcttcgaccctggcgccaagtaccacgtgccgggcaacacgccgtac
acgcgctatttcctggcgcatatcctgcaattccaattctacaaaggcctgtgccaggcc
gccggccatcaggggccgctgtacgaatgcagcttctacggcaacaaggacgccgggcag
aagttctggtcgatgctgcagcgtggttccagccaaccctggcagaccacactcaaggaa
ctcaccggcaacgacaaactcgatgccggcccgatgctggaatacttcgcgccgatgagc
gaatggctcaagcagcagaatcaagggcagatgtgcgggtggcaggcaacggccgccgct
ccggcaaccacgacgactgcgcctgcgacggcgcgctga

DBGET integrated database retrieval system