KEGG   Xanthomonas sacchari: SB85_07140Help
Entry
SB85_07140        CDS       T03566                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xsa  Xanthomonas sacchari
Brite
Enzymes [BR:xsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     SB85_07140
Peptidases [BR:xsa01002]
 Metallo Peptidases
  Family M2
   SB85_07140
Exosome [BR:xsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SB85_07140
CD molecules [BR:xsa04090]
 Proteins
  SB85_07140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1738057..1740075
Genome map
AA seq 672 aa AA seqDB search
MTHRSPLLALCLGASLLTLSACRKEPAAETAAPAAAQPQGESADQFVARINEEYRALLPE
LTAAQWLSATYINGDSERLAARANARWLTTLNGWIAQARRYDGKPMSADSARALRLLQQM
TAMPAPRDPARLGELAALATKMEGAYGAASYCTGEGDARRCRQLGELEDVLRRSRDYDQQ
LDAWQGWHAAVQPMRKDYQRFVELVNEGARDMGYADTGALWRSGYDMPPAQLAAETDRLW
TQVKPLYEQLHCYARGKLDAEYGKDKGELAGGLLPAHLLGNMWQQDWSNLWDLLQPYPGA
GSLDITDALERQYQGNLSAALARRNGDTSPEARFMAQREAQLLSARQMTERAQDFYTSLA
MPKLPDSYWTRSQFIKPLDRDVVCHASAWDMDMAGDVRTKMCVKPNEEDFTTIYHELGHV
YYDLAYNPLPPLFQAGANDGFHEAIGDTVVLAMTPQYLHSIGLVDAPQVGREALINAQMR
MALSKVAFLPFGLMIDRWRWGVFDGSIAPDRYNQAWWELKARYQGVAPATPRGEDFFDPG
AKYHVPANTPYTRYFLSHILQFQFYKSLCDAAGYKGPLYECTFYGNKEAGQKFWSMLQRG
ASQPWQATLKELTGSERIDAGPLLEYFAPMQEWLKQQNQGRMCGWEASAQMPAQTAAPAS
PTPTPTTPAPRR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
gtgacccatcgctctccgctgctcgcgctgtgcctcggcgcgagcctgctgacgctgtcc
gcctgccgcaaggaacccgcggccgagaccgccgcccccgccgcggcccagccccagggc
gagagcgccgaccagttcgtcgcccgcatcaacgaggagtaccgcgcgctgctgccggaa
ctgactgcggcgcagtggctgtcggcgacctacatcaacggcgacagcgagcgactggcg
gccagggccaacgcgcgctggctgaccaccctcaacggctggatcgcgcaggcccggcgc
tacgacggcaagccgatgtcggccgacagcgcccgcgcactgcgcctgctgcagcagatg
accgcgatgccggcgccacgcgatccggcgcggctgggcgaactggccgccctggcgacg
aagatggagggcgcctacggtgccgcgtcctactgcaccggcgagggcgacgcgcgccgt
tgccggcagttgggcgaactggaggacgtgctgcgccgcagccgcgactacgaccagcaa
ctggatgcctggcagggctggcacgccgccgtgcaaccgatgcgcaaggactaccagcgc
ttcgtcgaactggtcaacgaaggcgcgcgcgacatgggctacgccgacaccggcgcactg
tggcgcagcggctacgacatgccgccggcacagctcgccgccgagaccgaccggctgtgg
acgcaggtcaagccgctatacgaacaactgcactgctacgcgcgcggcaagctcgacgcc
gaatacggcaaggacaagggcgaactggccggcggcctgctgccggcacatctgctcggc
aacatgtggcagcaggactggagcaacctgtgggacctgctgcagccctaccccggcgcc
ggcagcctggacatcaccgacgcgctggagcggcagtaccagggcaacctgagcgcggcg
ctggcgcggcgcaatggcgacacctcgccggaagcgcggttcatggcccagcgcgaggcg
cagttgctcagcgcacggcagatgaccgagcgcgcgcaggacttctacacctcgctggcg
atgcccaagctgcccgacagctactggacgcgcagccagttcatcaagccgctggaccgc
gacgtggtctgccacgccagcgcctgggacatggacatggccggcgacgtgcgcaccaag
atgtgcgtcaagccgaacgaagaggacttcaccaccatctatcacgaactcggccacgtc
tattacgacctggcctacaacccgctgccgccgctgttccaggcgggtgccaacgacggc
ttccacgaagccatcggcgacaccgtggtgctggcgatgaccccgcagtacctgcattcg
atcggcctggtcgacgcaccgcaggtcggccgcgaagcgttgatcaacgcgcagatgcgc
atggccctgagcaaggtcgcgttcctgccgttcgggctgatgatcgaccgctggcgctgg
ggcgtgttcgacggctcgatcgccccggaccgctacaaccaggcctggtgggagctgaag
gccaggtaccagggcgtggcgccggcgacaccgcgcggcgaggacttcttcgaccccggc
gccaagtaccacgtgccggccaacaccccctacacccgctacttcctctcgcacatcctg
cagttccagttttacaagagcctgtgcgacgccgccggctacaagggcccgctctacgag
tgcaccttctacggcaacaaggaagccgggcagaagttctggtcgatgttgcaacgtggc
gccagccagccgtggcaggccacgctcaaggaactgaccggcagcgagcgcatcgacgcc
ggcccgctgctggagtacttcgccccgatgcaggagtggctcaagcagcagaaccaggga
cggatgtgcgggtgggaggcgtcggcgcagatgccggcgcaaaccgccgcgcccgcgtct
cccacacccactccgaccacgccagcgccgcggcgctga

DBGET integrated database retrieval system