KEGG   Xanthomonas translucens: FD63_04890Help
Entry
FD63_04890        CDS       T03961                                 

Definition
(GenBank) peptidase M20
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xtn  Xanthomonas translucens
Brite
Enzymes [BR:xtn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     FD63_04890
Peptidases [BR:xtn01002]
 Metallo Peptidases
  Family M2
   FD63_04890
Exosome [BR:xtn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FD63_04890
CD molecules [BR:xtn04090]
 Proteins
  FD63_04890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1098482..1100485)
Genome map
AA seq 667 aa AA seqDB search
MNHRPLLLALCIGASVLALSACRKEASTETDTAPAPAAPGESADQFVARINEEYRALLPE
LTSAQWLSITYINGDSERLVSKANARWLTTLNGWIAQAKRYEGKPMSADSARALQLLKLM
TAMPAPRDPAKLAELATLASKMEGAYGAATYCTGEGDARRCRQLGELEDVLRRSRDYDQQ
LDAWQGWHGTAQPLRQDYRRFVELVNEGAREMGYADTGAMWRSGYDMPPAQIAAETDRLW
AQVKPLYEQLHCYTRGKLDAEYGKDKGEVAGGLLPAHLLGNMWQQDWSNLWDLLQPYPGA
GSLDITDTLEKQYQSNLGAALARRNGDTSPEARFMAQRDAQLQSAKQMTERAQDFYTSLA
MPKLPDSYWARSQFIKPLERNVVCHASAWDMDMAGDVRTKMCIQPNEEDFTTIYHELGHL
YYDLAYNPLPPLFQGGANDGFHEAIGDTIVLAMTPHYLHSIGLVEAPQRSREALINAQMR
MALSKVAFLPFGLMIDRWRWGVFDGSIAPEHYNQAWWELKARYQGVAPPTPRGEDFFDPG
AKYHVPGNTPYTRYFLSHILQFQFYKGLCDAAGYKGPLYECSFYGNKEAGQKFWSMLQRG
GSQPWQQTLKELTGNDKLDAAPLLEYFAPMQEWLKQQNQGQLCGWEAAKAVQAGAAAAPA
TPAPKPQ
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccaccgccctctgctgcttgcgctgtgcatcggcgcgagcgtgcttgcgctgtcc
gcgtgccgcaaggaagccagcaccgagaccgacaccgcgccggcgccggccgcacccggc
gaaagcgccgaccagttcgtcgcccgcatcaacgaggagtaccgcgcgctgctgccggag
ctgacctcggcgcagtggctgtcgatcacctacatcaacggcgattcggagcggctggtg
tccaaggccaacgcgcgctggctgaccacgctcaatggctggatcgcgcaggccaagcgc
tacgagggcaagccgatgtccgccgacagcgcgcgtgcgctgcagctgctgaagctgatg
accgcgatgccggcgccgcgcgacccggccaagctggccgaactggccactctcgcatcg
aagatggaaggcgcctacggcgcggcgacttattgcaccggcgagggcgacgcgcgccgc
tgccggcagctgggcgaactggaggacgtgctgcgccgcagccgcgactacgaccagcag
ctcgacgcatggcagggctggcacggcaccgcgcagccgctgcgccaggactaccggcgc
ttcgtcgaactggtcaacgaaggcgcgcgagagatgggctatgccgacaccggcgcgatg
tggcgcagcggctacgacatgccgccggcgcagatcgccgccgagaccgaccggctgtgg
gcccaggtcaagccgctgtacgagcaactgcactgctacacccgcggcaagctcgacgcc
gaatacggcaaggacaagggcgaggtcgccggcggcctgctgccggcgcacctgctcggc
aacatgtggcagcaggactggagcaacctgtgggacctgctgcagccctaccccggcgcc
ggcagcctggacatcaccgacacactggagaagcagtaccagagcaacctcggcgcggcg
ctggcgcggcgcaatggcgacacctcgccggaagcgcgattcatggcccagcgcgacgcg
cagctgcagagcgccaagcagatgaccgagcgggcgcaggatttctacacctccctggcg
atgcccaagctgcccgacagctactgggcgcgcagccagttcatcaagccgctggagcgc
aacgtggtctgccatgccagcgcctgggacatggacatggccggcgacgtgcgcaccaag
atgtgcatccagccgaacgaggaagacttcaccaccatctaccacgagctcggccacctt
tattacgaccttgcctacaatccgttgccgccgctgttccagggcggcgccaacgacggt
ttccacgaggcgatcggcgacaccatcgtgctggcgatgaccccgcactacctgcattcg
atcggcctggtcgaagcgccgcagcgcagccgcgaggcgctgatcaatgcgcagatgcgc
atggcgctgagcaaggtcgccttcctgccgttcgggctgatgatcgaccgctggcgctgg
ggcgtgttcgatggctcgatcgcgccggagcactacaaccaggcctggtgggaactgaag
gccaggtaccagggcgtggccccgccgacgccgcgcggcgaggatttcttcgaccccggc
gccaagtaccacgtaccaggcaacacgccgtacacgcgctacttcctgtcgcacatcctg
caattccagttctacaagggcctgtgcgacgcggccggctacaaaggcccgctgtacgag
tgcagcttctacggcaacaaagaagccgggcagaaattctggtcgatgctgcagcgtggc
ggcagccagccgtggcagcaaacgctgaaggaactgaccggcaacgacaagctcgacgcc
gcgccgctactggaatatttcgcgccgatgcaggagtggctcaagcagcagaaccagggg
cagctgtgcggctgggaggcggcaaaggccgtgcaggcaggcgccgccgcggctcccgcg
acgcctgcgcccaagccgcagtaa

DBGET integrated database retrieval system