KEGG   Xenopus tropicalis (western clawed frog): 100124743Help
Entry
100124743         CDS       T01011                                 

Gene name
setdb2, clld8, clll8, kmt1f
Definition
(RefSeq) SET domain, bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100124743 (setdb2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100124743 (setdb2)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100124743 (setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100124743 (setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 697 aa AA seqDB search
MERSTNARHSTLSSWTRESNTLSVLSKDVSLEDAKEYWKDCQADGKVDWIFEKLLNKLKI
LWQKIKDGSATNLEYVRAVILVNEAEQLEEDTETLHTDIQKENKVQENTDCAPERKEDSC
ADLNSDCETDVSGSECEHEDHSTVSPPATGAVCFGKHLCGPSCLSDINPSLLKKENPLNL
PVSCDFQRWRVKTNGSEYPPHILYKAPCGRSLRDSDEVHSYLTETGCHFLGVDNFSFSTQ
VQLESHLSIKQEIVQDCDISNDVESVPVSLSNEIDDTRPTNFIYRKTSWPPGYSINNFTD
IFVKCCSCTDGCLDISTCSCLQLTAQAFEKFTDSSLGIGPLGYKHKRLQEPVPTGLYECN
LSCKCDRTLCQNRVVQHGLQLRLQVFKTDTKGWGVRCLDDVDNGTFVCIYAGRILIRTAD
SSVKTTLEDSVACGNEAKEDNGSTSTLMLSKRKRKPSHSDSEVTVMHLTPYSMRSLGLSV
HRQSNTLSLTHLRSGGREISLEPFRRPKTKTSMLQKRRRQLIEEGACTVHNSSEEEGPTP
PQSPKQKFNAGRKIHRNENSDETASGYVSEESSSSVISGGHPSEKPTCRTKSKLNKMTPH
LSTSPEQTCEEDLHFLDASKEGNVGRFLNHSCCPNLFVQHVFVDTHQKSFPWVAFFTNSV
VKAGTELTWDYNYVIGTAPDQEIQCLCGQQTCKHKIV
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagcggagtaccaatgcacgccattcaaccctgagttcctggacacgagaatcaaat
acattatctgttttatccaaagatgtatcactcgaagatgctaaagaatactggaaagat
tgtcaagcggatggaaaagtagactggatatttgagaaactattgaacaagctcaagatt
ctttggcagaaaataaaagatggatcagcaacaaacttagaatatgtgagagctgtgatt
ttggttaatgaagcagagcaactagaagaggacactgaaaccctccacactgatatccaa
aaggaaaataaagtacaagaaaacacagattgtgcaccagaaagaaaggaggactcgtgt
gcagacctgaattctgattgtgagactgatgtttcaggttctgagtgtgagcatgaggac
cacagcacagtttcacctcctgccaccggggcggtctgttttggaaagcatttatgtggc
ccatcttgtctctctgacattaatccatctctgttgaaaaaagaaaaccctctaaacctc
ccagtgtcctgcgacttccagagatggcgtgtaaagacaaatggctccgaatacccgcca
catatcctatataaagctccatgtgggagaagcctgagagattctgatgaagtgcattct
tacctcactgaaactgggtgccactttttaggtgtggacaacttttctttcagtactcag
gttcagctggagagccatttatccatcaagcaggaaattgttcaggactgtgatataagc
aacgatgttgagtcggtgccagtttcactctccaatgaaattgatgacacaagaccaact
aatttcatctacagaaagacctcttggcccccaggatactccataaataattttacagac
atctttgttaaatgctgcagttgcactgatggctgcttagatatttcaacttgttcatgc
ctgcagctcaccgcacaagcatttgagaaatttacagattcatcccttggtattggtccc
cttggctataaacacaaaagacttcaagaacccgttcctactgggttatatgaatgtaac
ttgtcatgtaagtgtgatcggacgttgtgccagaatcgagttgtgcagcacggccttcag
ttgagattgcaggtgttcaaaacagatactaagggctggggtgtccgctgtctggatgat
gtagacaacgggacatttgtttgcatctatgcagggagaatactaatcagaactgctgat
tcttctgtaaaaaccacactagaggattctgtggcatgtggtaatgaagctaaagaagat
aatggaagcacttctactctaatgttaagcaaacggaaaagaaagccttcccattcagac
tctgaagtcacagttatgcatttaactccctacagcatgcgcagcctgggattatctgtc
cataggcaatcaaacacactcagtctaacacatctaagatctggtggaagagaaatatct
ttggagccgtttagaagacccaaaaccaagacctccatgctccaaaagcgtagaaggcag
ctgattgaagagggggcatgcacagttcacaacagttcagaagaggagggtccaacaccc
ccacagtcacctaagcagaagttcaatgcaggaaggaaaatacatagaaatgaaaattcc
gatgagactgcctcagggtatgtgtcagaggagagcagcagttcagttatatctggggga
catccttcagaaaaacccacatgcaggactaagtcaaagctaaacaaaatgactcctcat
ctatctacctctccggaacagacttgtgaagaagacttgcatttcttagatgcctcaaaa
gaggggaatgttggaagatttctaaatcacagctgctgtcctaatctgtttgttcagcat
gtatttgtggatacacaccaaaaaagttttccatgggtggcattctttactaacagtgta
gtaaaagctggaacagaactaacctgggactataactatgttattgggactgcacctgat
caggaaatccaatgcctgtgtggccaacaaacatgcaaacataaaattgtatga

DBGET integrated database retrieval system