KEGG   Xenopus tropicalis (western clawed frog): 100144634Help
Entry
100144634         CDS       T01011                                 

Gene name
ace, ace1, cd143, dcp, dcp1, xace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100144634 (ace)
Peptidases [BR:xtr01002]
 Metallo Peptidases
  Family M2
   100144634 (ace)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100144634 (ace)
CD molecules [BR:xtr04090]
 Proteins
  100144634 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
10
AA seq 1284 aa AA seqDB search
MRVLLLGLLLLVGTNSALDSSFLPGTYPKDEAGARDFADAYNSTAEVILFKSVEASWAYN
TNLTDYNSKQQILASMEEQEFNEAWGMKAKELFNDVWENFTDPLLKKIISSIRTLGASNL
NLTAREEYNTILSEMDSIYSTAKVCPPNATAKCWSLEPEITEIMATSRSYKKLLYAWEGW
HNSAGIPLKEKYLRFVQLSNEAYRMDGYKDTGAYWRSWYASPTFEEDLDGLYQQLEPLYL
NLHAFVRRKLYERYGAKYINLKGPIPAHLFGNMWSQQWNNIYDMMIPFPDKTNIDVTNTM
REKGWNATHMFRVSEEFFTSLGLLEMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDF
RIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTYRRGANPGFHEAIGDVLSLSVSTPG
HLKTIGLLETVTNDKESDINYLLKMALEKIAFLPFGFLIDQWRWNVFSGRTPPTRYNYDW
WNLRTKYQGICPPISRDDNQFDAGAKYHIPGNTPYIRYFVSFVLQFQFHKALCTAAKHTG
PLHTCDIYRSQEAGKILGDVLRSGSSKSWQEVLKDMTGSEKMDVGPLLEYFTPVTQWLIE
QNTKNNEILGWPDFSWTPPMPDGYPGDIEKIANEKEADTFLSDYTKSAEVVWNDYTEASW
AYNTNITEANKQVMLDKNLAMSGHTLQYGLQARNYDYSDFQDPETQRILRKLSEIDKAAL
SEEEQKEYNQITSDMETIYSVAKVCKDGNTNCHPLDPDLTEILAKSRDYDELLFAWKGWR
DASGKQIREKYKRYVQLANKAAQLNGYNDNGAYWRSWYETPTLESDVEKLYDELQPLYLN
LHAYVRRALYKKYGDKRINLKGPIPAHLLGNMWAQSWSNIYELLVPYPNAAQVDATPAMI
AKNWTPKRMFEESDNFFKSLGLLPMPQEFWDKSMIEKPKDREVVCHASAWDFYNRKDFRI
KQCTVVNMDDLITVHHEMGHVQYFLQYKDQPILFREGANPGFHEAIGDVLALSVSTPKHL
QSIGLLDKVEDNPESDINYLMSIALDKIAFLPFGFLMDQWRWKVFDGRTPDSEYNQQWWN
LRLKYQGLVPPVLRTENDFDPGAKFHIPASVPYIRYFISFVIQFQFHEALCKAANQEGPL
HKCDIYQSTQAGKLLGDAMKLGNSKPWPEAMQTITGQRNMSAHALLKYFQPLTDWLIKEN
TKNGETLGWPEYNWSPVQSVPLPPSGDSNSDFLGLAVSNSQAAAGQWILLALGIVLIITT
IVFGVLYSKMKSRAKMSSSQMELK
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgcttctcctggggctcctcctgctggtgggcaccaattcagccctggacagc
tccttcctgccaggcacctaccccaaggatgaggctggtgccagagactttgccgatgcc
tacaacagcacagcagaggttatcctattcaagagtgtggaagccagttgggcatataac
accaacctgactgactacaactccaagcagcagattctagcttccatggaggagcaggag
tttaatgaggcatggggtatgaaggctaaggaacttttcaatgatgtgtgggaaaacttt
acagatccattactcaagaaaattatcagttctataaggaccctcggagcatcaaacttg
aacttgactgcaagagaggagtataacaccattctaagcgagatggacagcatctattca
acagccaaagtttgccctcccaatgcaactgcgaaatgctggtctttggaacccgaaata
acagagatcatggcaacatccaggagttacaagaagcttctctatgcctgggaaggctgg
cataactctgcagggattccactaaaggagaaatacttacgatttgtgcagctcagtaat
gaagcttacaggatggacggatataaggacactggtgcctactggcgctcttggtatgca
tctcccacatttgaagaggacctggatggcctataccaacaactagaacctctatacctc
aatctacatgcctttgtacgcaggaaactgtacgagcgctatggggctaaatatatcaac
ttgaaaggaccaattccagctcatctgtttggtaacatgtggtcccagcagtggaataat
atctacgacatgatgattcccttcccagacaagaccaatatagatgtcactaatacaatg
agggaaaagggatggaatgctacccatatgttcagagtttcagaggagttcttcacctcc
ctgggtctgctggagatgcccccagagttttgggaaaagtcaatgttggaaaaaccagca
gatggacgtgaggtggtgtgtcatgcatctgcatgggacttctacaaccgtaaggacttc
cggataaagcaatgcactacagtcactatggagcagctcttcactgtgcaccatgagatg
ggccacgtggagtattacctgcagtataaggatcagccggtcacataccgccggggggca
aacccaggcttccatgaggccataggagatgtgctctccctttcagtctcaaccccagga
cacctgaaaacaattgggcttcttgaaactgtcactaatgataaagaaagtgatatcaat
tatctgttgaaaatggctctggagaaaattgccttcctgccatttggcttcctgattgat
cagtggagatggaatgtcttcagtggccgcacacctcccaccagatacaactacgactgg
tggaaccttcgaacaaaatatcaaggtatctgcccaccaatctcaagagatgataaccaa
tttgatgctggggcaaagtatcatattccaggcaacacaccttacatcaggtactttgtg
agttttgtgctgcagttccagttccataaggctctctgtacagcagccaaacatacaggt
cccctgcatacatgtgatatttacagatcccaggaggctggaaaaattcttggagatgtt
ctccggtcaggatcctccaagtcttggcaggaggttctgaaggacatgacaggtagtgaa
aagatggatgttgggcccttgcttgaatacttcacccctgtcacacagtggctgattgag
caaaacaccaaaaataacgagattctcggctggccggatttttcatggacgcctccaatg
cccgatggatatccaggagatattgaaaaaattgcaaatgagaaagaagctgatactttc
ctgtccgattataccaagtcagcagaggtggtgtggaacgattatactgaggcatcatgg
gcctataacacaaacatcactgaggccaacaagcaagttatgctggacaaaaacctggcc
atgtcgggacacaccttacaatatgggctgcaggcaagaaactacgattacagtgatttc
caggaccctgagacacagcgcattctgaggaaactcagtgagatcgataaagctgctctt
tcagaggaggaacagaaagagtacaatcaaatcacatccgacatggagactatttatagt
gtggccaaagtttgcaaggatggtaacacaaactgccatcctcttgatccagacctaaca
gagatcttggccaagtctcgggactatgatgagcttctgtttgcttggaaagggtggaga
gatgcttcaggcaaacaaatccgtgaaaaatacaagagatatgtacaattggccaacaaa
gctgcacagctcaatggttacaatgacaatggagcatactggagatcttggtatgagacc
ccaacacttgaatcagatgttgagaaactttatgacgagttgcagcctctctacctcaat
ttgcatgcatatgtgcgcagggctctttacaagaagtatggagataaaagaatcaaccta
aaggggccaattcctgctcatctcttgggtaacatgtgggcacagtcctggtctaacatt
tatgagttgttggttccatatcccaatgctgcacaagtggatgctactccagccatgatt
gctaagaattggactccaaaaaggatgtttgaggaatctgacaacttcttcaagtctctg
gggcttctcccaatgccacaggaattctgggataaatccatgatcgagaagcctaaagac
agagaggtagtgtgccatgcatctgcttgggacttctacaaccgcaaagatttcaggatt
aaacagtgcacagtggtaaacatggacgacctaatcacagtccaccatgagatggggcac
gttcaatatttccttcagtacaaggatcagcctatcttgttccgtgagggagccaaccca
ggtttccatgaggcaattggggatgtgcttgctctttcagtctctacaccaaaacacttg
caaagcattggccttttggataaggtggaggacaacccagaaagtgatattaattatctc
atgagtattgcactggataaaattgccttccttccatttggtttcctcatggatcagtgg
cgctggaaggtgtttgatggaagaacaccagattcagaatacaaccaacagtggtggaac
ctcaggttgaagtatcagggccttgttcctccagtactaaggactgaaaacgattttgat
ccaggtgctaaattccacattccagccagcgtaccctacatcaggtacttcatcagtttt
gtcatccagttccagtttcatgaagctctttgtaaagcagcaaatcaggaaggacctctg
cacaaatgtgacatctaccaatccacgcaggctggaaaactgctcggagatgccatgaag
ttgggaaacagcaaaccttggccagaagctatgcaaacaattactggacaaaggaacatg
tctgctcatgcccttctcaaatacttccagcccctgactgactggcttatcaaggagaat
acaaagaatggcgaaaccttaggatggccagaatacaactggagcccagtacaatccgtt
cctctgccaccgtctggagattctaactctgacttcttgggactggcggttagcaatagc
caagcagctgctggacaatggattctcctggctttgggcattgtcctcatcatcaccacc
attgtctttggtgtgctatactcaaaaatgaaaagcagagctaagatgtccagctctcag
atggagctgaaatag

DBGET integrated database retrieval system