KEGG   Xenopus tropicalis (western clawed frog): 100488045Help
Entry
100488045         CDS       T01011                                 

Gene name
b3galt1
Definition
(RefSeq) Beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
xtr01100  Metabolic pathways
Module
xtr_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100488045 (b3galt1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     100488045 (b3galt1)
Glycosyltransferases [BR:xtr01003]
 Glycan extension
  Type 1 chain
   100488045 (b3galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 100488045
NCBI-ProteinID: XP_004917762
Xenbase: XB-GENE-988816
UniProt: F6ZSD3
LinkDB All DBs
Position
9
AA seq 324 aa AA seqDB search
MASKVSCLYILTVVCWASALWYLSVTRPTSYSSHRVGDVTIVQKNVTFGNIRTRPINPHS
FEFVINEPEKCGKDGPFLVILISTTHKEFDARQAIRETWGNESNFKGIKIVTLFLLGKNS
DPVLNQMVEQESQIFHDIVVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYIMKTDSDIFV
NMDNLIYKLLKPTTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPESNYPPFCSGTGYI
FSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVIT
VHQIGPEEMHRIWNDMSSKKHLRC
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcatgtttatatatcctgacagttgtgtgctgggcaagcgccctg
tggtatctaagtgttactcgcccaacttcatactcatcccacagagttggcgatgtaacc
attgttcaaaagaatgttacctttggaaacatcagaactcgacctataaacccgcattct
ttcgaattcgttataaatgagcctgaaaaatgtggaaaagacggccctttcctggtgatc
cttataagcacaacccataaggaatttgatgcccgacaagcaattcgagaaacctgggga
aacgaaagcaactttaaagggattaaaatcgtcacgctttttcttttaggcaaaaattca
gacccggtcttaaatcagatggttgagcaagaaagtcagatctttcatgatattgttgta
gaagacttcatcgactcctaccacaacctgactctcaaaaccctgatgggcatgaggtgg
gttgccaccttctgctcaaaagcaaagtatatcatgaaaacagacagtgacatttttgta
aatatggataacctgatttataagttactaaaacccaccacgaagcctcggagaagatac
tttactggttatgtcataaatggaggacctataagggatgttcggagtaaatggtacatg
cctagagacttgtacccggagagcaattaccctcctttctgttcaggaactggctacatt
ttttccgctgatgttgcggaactcatttataaaacttcccttcataccagactgttgcat
cttgaagatgtctacgtagggctttgtttacggaagctcggtattcacccatttcaaaac
agtggctttaatcactggaaaatggcctacagcttgtgtagataccggcgggtaatcaca
gtgcatcagataggtcctgaagaaatgcacaggatctggaatgacatgtcaagcaagaag
catcttcgatgttaa

DBGET integrated database retrieval system