KEGG   Xenopus tropicalis (western clawed frog): 100493073Help
Entry
100493073         CDS       T01011                                 

Gene name
ptgs1, cox1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00590  Arachidonic acid metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100493073 (ptgs1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100493073 (ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100493073
NCBI-ProteinID: NP_001258184
Xenbase: XB-GENE-995315
LinkDB All DBs
Position
8
AA seq 588 aa AA seqDB search
MAGLCLTVLFVIVTTSYSLEVSDKVNPCCYYPCQHKGVCVRFEMDKYLCDCTRTGYYGTN
CTIPEWWTKFREFLRPSPAFYHYILTRFKWFWDIINSTFIRDVIVRLVLTVRSNLIPSPP
TYNSAYGYISWEAYSNVSYFTRVLPPVPDDCPTPMGTKGKMELPDASLLVETFLKREKFI
PDPQGTNLLFAFFAQHFTHQFFKTYGRMGRGFIKGFGHGVDLSHIYGDSLERQHMLRLFT
DGKLKYQIINGDIYPPTVVEAPVFMIYPDNVPKEKQFAVGQEVFGLLPGLMMYATLWLRE
HNRVCDILKKEHPTWDDEQLFQTTRLILIGETIKIVIEDYVQHLSGYYLKLKFDPELLFG
VQFQYRNRIAVEFNQLYHWHPLIPEKFQILEDEYSHSRFLYNTSILLDYGVEALVESFTK
QIAGKIGGGKNHHPGLLKVAAGVIEESRKLRLQPFNEYRKRFGLKAYKSFKDLTGEEIMS
AQLEELYGDIDALEFYLGLLLEKSNPNSIFGESMVEIGAPFSLKGLMGNPICSPEYWKPS
TFGGETGFNIVKTATIQKLVCLNVKQCPFVAFHVPDDVLPKLKKSDEL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggctggactttgtctcactgtgctgtttgtgattgtgaccacttcatattcattggaa
gtttcagataaagtgaatccatgctgctactacccatgtcagcacaagggtgtttgtgtg
aggtttgaaatggataaatacctatgtgactgcacccgaacaggttattatggtaccaac
tgcacaatccctgaatggtggacaaagtttcgggaatttcttcgtccaagtcctgctttt
tatcactacattttgaccagatttaagtggttttgggatataataaattctaccttcata
cgtgatgtcattgtgagacttgttttgacagtgcgttcaaatttgatacccagcccacca
acctacaattctgcatatggctacataagctgggaggcgtattctaacgtcagctacttt
acgcgggttcttccccctgtcccagatgattgtcctactcccatgggaacaaaaggaaag
atggaactcccagacgcttctcttcttgtggagacatttctgaaaagagaaaaattcatc
ccagacccgcaaggcacaaacctcctgtttgccttctttgcccagcatttcacgcatcag
tttttcaagacatatggcaggatgggacggggtttcattaaaggattcggtcatggtgtt
gatcttagccatatttatggagacagtttggaacgccagcatatgcttcgtctcttcaca
gatggaaaactcaagtatcagataataaatggggatatatatccgccaacagtggtcgag
gctccagtcttcatgatttatccagacaatgtccccaaggaaaagcagtttgccgtaggg
caggaggtatttggactcctccctggattgatgatgtatgcaaccctttggctccgtgaa
cacaatagggtttgtgatattctgaagaaggagcaccctacttgggatgatgagcagctg
tttcaaactacaagactaattcttataggggagactataaagatcgtcattgaagactac
gtgcagcacctgagtggatattatctgaaactgaaatttgatccagaattattgttcggc
gtgcagttccagtacaggaatcggattgctgttgagttcaaccagttatatcactggcat
cctcttattccggagaaatttcaaatactggaagatgaatacagccacagccgctttctc
tacaatacatccattcttttagactatggagttgaggctctggtggaatcttttacaaaa
caaattgctggcaagattggtggaggaaagaaccatcacccgggcctgctgaaggtggct
gcaggagttattgaagaatctcgaaaactcaggctacaaccttttaatgaatatcgaaag
agatttggtttgaaggcctataagtcattcaaagatttaacaggagaagaaattatgtca
gcacaactggaagagttgtatggagatatagatgcactcgaattctatttggggctactt
ttggaaaaatccaatccaaattcaatatttggagaaagtatggtggaaataggggcacca
ttttctcttaaaggactcatggggaacccaatttgctctccggaatactggaagcccagt
acctttgggggagaaactgggtttaatattgtaaagactgcaacgattcagaagcttgtg
tgtctcaatgtaaaacaatgtccctttgttgcattccacgtgccggacgacgtattacct
aaattaaaaaaatctgatgagctttaa

DBGET integrated database retrieval system