KEGG   Xenopus tropicalis (western clawed frog): 100496933Help
Entry
100496933         CDS       T01011                                 

Gene name
pcsk1
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1
  KO
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     100496933 (pcsk1)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S8: subtilisin family
   100496933 (pcsk1)
Chaperones and folding catalysts [BR:xtr03110]
 Intramolecular chaperones
  Subtilisin family
   100496933 (pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
1
AA seq 886 aa AA seqDB search
MFIWERTVYSSDAGSLGIASLVFAVQQLICGLLSMICLCVWASPAVMSELSVVELRAPST
CYFSLSPPSGIPYRLKTPGSVFDVVVTCKRHISNEAAKGPSIFLASERERNLLLLSVRIA
TRTKHPDLKFSLDSFRGFGSDTVRMEGRYWYPMCIASVAVLSLLCQVLAAGVDKRYMNEW
AAEIPGGPEEAQLLALELDYDYLGQIGSLENHYLFRHKAHPRRSRRSAPHLTKRLADDGR
VSWAEQQYSKERNKRSTFRQDTKNLFNDPLWNRQWYLQDTRSNPSLPKLDLHLLPVWKKG
ITGKGVVITVLDDGLEWNHTDIYANYDPEASYDFNDNDNDPFPRYDITNENRHGTRCAGE
IAMVANNNKCGVGVAYNAKVGGIRMLDGVVTDAKEASSIGFNPQHVHIYSASWGPNDDGK
TVEGPGRLAQKAFEYGIKQGRNGKGSIFVWASGNGGRQGDNCDCDGYTDSIYTISISSAS
QQGLSPWYAEKCSSTLATAYSSGDYTDQRIISADLHNECTETHTGTSASAPLAAGIFALA
LEFNPDLTWRDMQHLVVWTSEYDPLANNAGWKKNGAGLMVNSRFGFGLLNAKALVDLADP
KTWKGVAEKKECIVEDNEFSPRFLRSDGEVTIQIPTKACEGQDNHIKSLEHLQLEATIEY
TRRGDLHITLTSPLGTNTVLLTERERDTSPYGFKSWDFMSVHTWGEDPAGTWTLKISDVS
GRKKNEGRIVSWKLILHGTSTQPEHMKHPRVYTSYNVVQNDRRGAEKMDDIEKEPISESF
TTERPEVTKNTPDSQEAAERAKSLAIAHLLKNAFDRDGGSFPLEDKDIPKHSYLYALATI
SKQGEGRDRENDLYNEYIDRFYHSRPYKHRDDRLLQALFNILKKKP
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgttcatatgggagcgcactgtttactccagtgatgccggcagcctaggaatagcttcc
ctagtatttgcagtgcagcagctgatttgcgggctgctgagcatgatttgcctttgtgtg
tgggcgtctccagctgtaatgagtgagctcagtgtagtggagctgcgagcacccagcact
tgctattttagcctctcacctccctcgggaataccgtatagattgaagacgcctggaagt
gtgtttgacgtcgttgtgacgtgtaaaagacacatttccaatgaagctgctaaaggaccg
agcatttttctagcctcggagagagagagaaacctgctgctcttatctgttcgcatagca
accaggaccaagcaccccgatttgaaattctcattggactcttttaggggttttggctca
gacactgtgagaatggaaggacgatactggtaccccatgtgcattgcttcagtcgctgtc
ttgtccttgttgtgtcaggtgctagctgctggggtggataaacggtatatgaatgaatgg
gcagcagagatccccggggggcccgaggaagcccagttacttgcattggagttggattat
gattacctgggacagattggatccttagaaaatcactacctgttcagacacaaagctcat
ccaagaagatcacgcagaagtgcccctcatcttacaaagagactagctgatgatgggcgg
gtgtcgtgggcggaacaacagtacagtaaagagagaaataagcggtcaaccttcagacaa
gacaccaaaaacctgtttaatgatcccctgtggaatcgacaatggtacttgcaagacaca
agatcgaatccctcattgcctaagttggatttacatctccttcctgtatggaagaaagga
ataacaggcaaaggtgttgttatcacagtgctggatgatggtttggaatggaaccacact
gatatctatgccaattacgacccagaagcaagctatgatttcaatgacaatgacaatgac
ccctttcccagatatgatattacaaatgaaaacagacacgggacaagatgtgctggggaa
attgccatggttgccaataacaataaatgtggagtcggagttgcatataatgcaaaggtt
gggggcatacggatgctggatggtgttgtgacagatgccaaagaagcaagttccattggc
ttcaatccacaacatgtgcatatatacagtgccagctggggacctaatgatgatggcaaa
accgtagaaggaccgggtagactggcacagaaagcttttgagtatggcatcaaacagggg
cgaaatggaaaaggttccatctttgtttgggcatctggaaatggtgggcgacagggtgat
aactgtgactgtgatggatacacagacagcatttacaccatctctatcagcagtgcttcc
cagcaaggtttgtctccctggtatgctgagaaatgctcttccaccctggccacagcatac
agcagtggggactacacagatcagagaattataagcgccgacttacacaatgagtgcaca
gagacgcacaccggcacctctgcttcagctccgctggctgccgggatctttgctctcgca
ctggaatttaaccctgaccttacctggagggatatgcagcacctggtggtttggacatca
gagtacgacccgttggctaacaatgctggctggaagaaaaatggcgctgggctaatggtt
aatagcagatttggatttgggctgctcaatgctaaggcacttgtggatttagctgaccct
aaaacatggaaaggagttgcagaaaagaaggagtgtatagtagaagataatgagttttca
ccaaggtttctaagatcagatggggaagtaaccattcaaattcctacaaaagcctgtgaa
ggccaagataaccatatcaagtctctggagcacttgcagcttgaagccacaattgaatac
acccgtaggggggaccttcacattacactcacctctccattagggactaatacagttctt
ctgactgaaagagagagagatacttctccatatggtttcaaaagctgggactttatgtct
gtgcatacgtggggagaagatccagcgggaacctggacgctaaaaatctctgatgtgtct
ggaagaaaaaaaaatgaaggaagaatagtcagctggaaattgattcttcatggaacatcg
acccaaccggagcatatgaaacatccaagagtttatacttcctataatgttgttcaaaat
gatcgaagaggcgctgagaagatggatgacattgaaaaggaaccaatcagtgaaagtttc
acaactgagcggccagaagtcactaaaaacactccagacagtcaagaagctgctgaaagg
gcaaagtcgctagcaatagcccaccttttgaagaatgccttcgacagagacggaggttca
tttcctctagaagacaaagatatccctaaacatagttatttgtatgctctggccaccatt
agcaagcagggagaaggaagggacagagagaacgatttgtacaatgagtacattgacagg
ttctaccattccagaccttacaaacacagagatgatagactattgcaagctttgttcaac
attttaaagaagaaaccctaa

DBGET integrated database retrieval system