KEGG   Xenopus tropicalis (western clawed frog): 100497480Help
Entry
100497480         CDS       T01011                                 

Gene name
ogdhl
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100497480 (ogdhl)
  Amino acid metabolism
   00310 Lysine degradation
    100497480 (ogdhl)
   00380 Tryptophan metabolism
    100497480 (ogdhl)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100497480 (ogdhl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
7
AA seq 1018 aa AA seqDB search
MSHLRTVAAKLKPYCTGLLVKHSSTPRTLPQRCSVYSSGAKEPFLSGTNSSYVEEMYYAW
LENPKSVHKSWDIFFQSADAGTPQCETRGVPSLTGIESKLQSLSSQGLATAPAKAEKIVE
EHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTLDKLGFYGLHEGDLDKV
FRLPTTTYIGGIDSTLSLREIIRRLENSYCQHIGLEFMFINDVEQCQWIRQKFETPGIMK
FTNEEKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKVIIDKSSEMGLEYV
ILGMPHRGRLNVLANVIRKDLDQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRATNKK
ITLSLVANPSHLEAADPVVQGKTKAEQFYRGDSHGNKVMSVLVHGDAAFAGQGVVYETFH
LSDLPSYTTNGTIHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMY
VCSVAAEWRNTFNKDVVVDLVCYRRSGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKMI
AEGMVSLQEFEEEIAKYDRICEEAYARSKDKKILNIKHWLDSPWPGFFTLDGEPKSMTCP
PTGIPEDLLSHIGNIASSVPVTDFKIHGGLSRILKSRLEMTKNRTVDWALAEYMAFGSLL
KEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRKTCVPMNHLWPNQAPYTVCNSSLSEYGV
LGFELGFAMASPNALVLWEAQFGDFYNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEG
MGPEHSSARPERFLQMSNDDSDAYPEFTNDFEVCQLYDCNWIVVNCSTPASYFHVLRRQI
LLPFRKPLIIFTPKSLLRHPEAKSSFDDMNTGTNFQRVIPENGAASHNPQAVKRVIFCTG
KIYYELVKERHNKGLDNQVAITRLEQLSPFPFDLVKQEAEKYATSELVWCQEEHKNMGYY
DYVKARFLTILNHARPVWYVGRDPAAAPATGNKNTHHVELKRFLDVAFNLQYFEGKPF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacctcaggacagttgctgctaaattaaaaccatactgtactggtttgctggtg
aaacacagctccacccccaggacattgccccaaagatgttctgtgtattcatcaggagcc
aaagaacctttcttaagtggaaccaattccagttatgtggaagaaatgtattacgcatgg
ctggagaatccaaaaagcgtccacaagtcctgggacatttttttccaaagtgctgatgct
ggaacccctcaatgtgaaacacggggtgtgccatcattgactggtatagagagtaaattg
cagtccctttctagtcaaggattggccacggcaccggccaaagcagagaagatagtggaa
gagcatctggctgtgcaatctttgatcagagcataccagatccgtggacatcatgtcgcg
caactggacccactaggaatcttagatgcagacttggactcatttgttccttctgatcta
atcacaactcttgacaagctaggcttttatgggttgcatgaaggagatttggacaaagtt
ttccgcttgccaacaaccacttacattggaggcatcgattctactctgtctctgcgagag
atcatcagaagattggagaattcatattgtcaacacattggtctggagttcatgttcata
aatgatgtagaacagtgccagtggattcgacaaaagtttgagactcctggcatcatgaag
tttacaaatgaagagaaacgaacacttctagcaagacttgtacggtccaccaggtttgaa
gacttcctggcacgcaaatggtcatctgaaaagagatttggcttggaagggtgtgaggtg
atgatcccagcgttgaaggtgattatagacaagtctagtgagatgggattggaatatgtc
atacttgggatgcctcacaggggcaggctgaatgtactggcaaatgtgattcggaaggat
ttagatcagatcttctgccagtttgaccctaagctggaggcttcggatgagggatcaggg
gatgtgaaatatcacttgggaatgtaccatgaacgcattaatcgtgccacaaacaagaaa
attaccctatctttggttgctaatccctcccatttggaggctgcagatcccgtggtacaa
ggtaaaacaaaggcagaacagttttatcgaggagacagtcacggaaataaggtaatgtca
gtactggttcatggtgatgctgcctttgctggacaaggtgttgtatatgaaactttccac
ctcagtgaccttccttcatataccaccaatggaacaatccatattgttgtcaataaccag
attggctttaccacggatcctcgaatggcacggtcttctccgtaccccacagatgtggcg
agggtggttaatgcacccatattccatgtaaatgcagatgaccctgaagctgtcatgtac
gtgtgcagtgtggctgctgagtggaggaataccttcaataaagatgtagttgtggatttg
gtctgttaccgtcgtagtgggcacaatgaaatggatgagcccatgttcactcagccattg
atgtataagcagattcacaagcaggttccagttcttaagaagtacgctgacaaaatgata
gctgaaggcatggtttctttgcaagagtttgaggaagagattgcaaagtatgatagaatt
tgtgaagaggcctatgctaggtccaaagataagaaaattctcaatataaagcactggttg
gactcaccatggccaggatttttcactttagatggtgaaccaaagagtatgacgtgtccc
ccaactggtattcctgaagacttgctctcccatattggtaatattgccagttcagtgcct
gtgacagatttcaaaattcatggaggactctctaggattctgaagagcagactggaaatg
acaaagaatcgtacagtggattgggcactggcagaatacatggcatttggatctttgctg
aaagaaggaatccatgtcagacttagtgggcaggatgtagaaagaggaacgtttagtcat
cgtcatcatgttctgcatgatcaggaggttgaccgtaagacttgcgttccaatgaatcat
ctttggccaaaccaagctccttacacagtgtgcaacagttccttgtctgaatatggcgta
cttggttttgagcttggctttgccatggcaagccccaatgctttagtgctttgggaagca
cagtttggggatttttataacacagctcagtgcataattgaccagtttatcagctctggg
caggctaaatgggtccgtcacaatggaatcgtgctactgctacctcatgggatggaagga
atggggcctgagcattcatcagccagacctgaaaggtttctgcagatgagcaatgacgac
tctgatgcttatcctgaatttacaaatgattttgaagtttgccagctttatgactgtaac
tggattgtggtgaactgttctactccagccagttattttcatgttcttagaagacaaatt
ctgctgcccttccgtaaacctctaattatttttacacctaaatcattgctgaggcatcca
gaagcaaaatctagctttgatgacatgaacacaggtacaaattttcagcgtgtgattcct
gaaaatggtgcagcatcccacaatcctcaggcggttaaaagggtcattttctgcaccggg
aaaatttattatgagctggtaaaagagagacacaacaaagggttggataaccaagtggct
atcactaggttggagcagctctcgccgtttccctttgatttggtgaagcaagaagctgag
aagtatgccacctcagaactggtttggtgccaagaagaacacaaaaatatgggatattat
gactacgttaaagcacgttttctcaccatcctaaaccatgcaaggcctgtttggtacgtt
ggtcgggacccagcagcagctccagccactggaaataagaacactcaccatgtagaactc
aagagatttctggatgttgcctttaatttgcaatattttgaaggaaaacccttctga

DBGET integrated database retrieval system