KEGG   Xenopus tropicalis (western clawed frog): 101732100Help
Entry
101732100         CDS       T01011                                 

Definition
(RefSeq) transmembrane protease serine 9-like
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
9
AA seq 518 aa AA seqDB search
MVLFLYNSAAGRKPVAISDRIVGGQDAKKGKYPWQALLWCPGVYRCGGTLVSSKWVVSAA
HCLSRSNASCLAVILGANKLSGNENEEMAVSVKNIYIHPNYNDTDITNDIGLAELTQAVS
FTSYVIPVCLPTASTIFNPGQSCWVTGWGVTEFNTSLSPNTLQEVQMRILSAEQCRSYYD
PNITGVYITDQMICARDILGGKDSCQGDSGGPLVCSYGGNFYLVGVVSFGIGCGDTAYPG
VYTYVPAYRDWIGKYVPSVSTTSSGSARIGFTYGPTLKGLSLMSFFHSLCWVLLGDLWFV
LIISMAAWMSNTKSSFQVFVGDYNLDNKDKGEQPVSVKRIIIHPSYREGYLNDNIALLEL
ATKVQMNKVTLPVCLPDASVTFPDGQKCSVTGWGQIMDGADPPSPRVLREVEVKMMSNDR
CNTLFNIPDAYGRTTANLTDTMLCAGYAKGGRDSCNGDVGGPLVCPKDGRWYLAGVVSGG
DGCGKPNRPGIYTRVSSYIKWITGVAPEVTGNVLNVKY
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggtgctattcttgtacaactctgcagccgggagaaaacccgtcgcaatcagcgatcgc
attgtgggagggcaggatgcaaagaagggcaagtacccctggcaggcgttgttgtggtgt
cctggtgtataccgctgtggtgggactctcgtcagtagcaagtgggtcgtgtcagcagct
cattgcttatcaaggtcgaatgcttcctgtcttgctgttattctgggagccaacaaatta
agtggaaatgaaaacgaggaaatggcggtctctgtgaaaaacatctatatacaccctaat
tacaatgacacggatatcactaatgatattggccttgcagagctcacacaggccgtgtcc
tttacgagctacgtcattccggtttgtctgcctacagcttccaccatatttaatcctgga
cagagctgttgggtgactggctggggagttactgaatttaatacttccctaagtccaaat
accctgcaagaagtacagatgcgaatcctaagcgcggagcaatgcaggagttattatgac
ccaaatataaccggtgtttacattacggaccagatgatatgtgcaagggacatccttggt
gggaaagactcctgtcagggtgacagtggaggaccccttgtttgttcttatggaggaaac
ttttatttggttggagtggtgagctttggcattggttgtggagatacagcctacccaggg
gtgtatacgtatgtgcctgcctatagggactggattgggaaatatgttcccagtgtctct
actacctctagtggctcagcaagaataggattcacgtatgggccaacactcaagggcttg
agtttaatgtccttcttccattcgctctgctgggtgctactgggagatctttggtttgtc
ctgatcataagcatggcagcttggatgagcaacactaaaagttctttccaagtttttgtt
ggagactacaatctcgacaataaagacaagggagaacagcctgtttcagttaaacgaatc
attattcatccttcgtaccgcgaagggtatctcaatgacaacatcgctctcttggagctg
gccacaaaggtgcaaatgaataaagtcaccctgccggtctgtctgcctgatgctagtgtg
acattcccggacggccaaaagtgttctgtgaccggctggggtcaaataatggatggtgct
gacccaccaagtcctagggttctgagggaagtagaagtgaaaatgatgagtaacgaccga
tgcaacacattattcaacattcccgacgcctacggccgcacaactgccaatttgacggat
accatgttgtgcgcaggatacgccaaaggcggcagagactcctgcaatggtgatgttgga
gggcccttggtttgtcctaaagatggccgctggtatttggctggtgtggtgagcggagga
gatggttgtgggaagccaaatcgccctggaatctacactcgcgttagttcctatattaaa
tggattactggagttgctcctgaagtcactgggaatgtgcttaatgtgaaatattag

DBGET integrated database retrieval system