KEGG   Xenopus tropicalis (western clawed frog): 549262Help
Entry
549262            CDS       T01011                                 

Gene name
suv39h2, kmt1b
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    549262 (suv39h2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     549262 (suv39h2)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     549262 (suv39h2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    549262 (suv39h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 406 aa AA seqDB search
MAAARGAWCVPCLASIETLQELCRKEMLICTNIGITRKNLNNYEVEYLCDYRIEKGVEKF
FVKWKGWPESCNTWEPTRNLKCPTLLKQFYSDLYNYFCALKPNKKGFLKNSIKSLDPSLS
DYIVKKAKQRIALRRWEEELNRKKTHSGTLFVENTVDLEGPPMDFYYINDYKASPGVNTL
GEAIVGCDCSDCFKGKCCPTEAGVLFAYNEHRQIKIPPGRPIYECNSRCKCGPDCPNRVV
QKGPPYSLCIFRTDNGRGWGVKTLQKIKKNSFVMEYVGEVITSEEAERRGQQYDSRGITY
LFDLDYEADEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDVRLPRIALFSTRNIKA
GEELTFDYQMKGSGDFSTDSIDMSPAKKRVRIACKCGAATCRGYLN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcgcgtggagcttggtgtgtgccatgccttgcttccatcgaaacattgcag
gagttgtgcaggaaagaaatgctcatttgtacaaacattggaattaccaggaaaaattta
aataattatgaagtagaatatctatgtgactacaggattgaaaagggtgtagaaaaattc
tttgtgaagtggaagggatggccagagtcttgtaatacttgggagcctacaagaaacttg
aaatgcccaacgcttttaaaacagttttacagtgacctttacaattatttctgtgcactt
aaaccaaataaaaaagggttccttaaaaacagcattaagtctttggacccttctctttct
gactatatagtcaaaaaggctaaacagaggattgctttacggcgctgggaagaagagctg
aacaggaaaaaaacccatagtggtactctttttgttgaaaatactgtcgatttagagggt
cctcctatggacttttactatatcaatgattacaaggcctctcctggagttaacacattg
ggtgaagccattgttggctgtgactgctcggattgctttaaaggcaaatgttgtcccaca
gaagcaggagtcctctttgcatataatgaacacaggcaaataaaaatcccaccaggaaga
ccaatttatgaatgcaattcaagatgcaaatgtggtccggattgtcctaacagggtggtg
caaaaggggccaccctattccttatgcatctttaggacagacaatggtcgtggctgggga
gtaaagacactccaaaaaataaagaaaaatagttttgtgatggagtatgttggcgaggta
ataacaagtgaggaggcagagcgaaggggtcaacagtatgacagcagagggatcacatat
ctgtttgatctagactatgaggcagatgagtttacagttgatgcagctcgatatgggaac
gtctcgcattttgtgaatcacagttgtgatccaaaccttcaggtatttaatgtcttcatt
gataatcttgatgtacgtcttccacgtattgcgttgttttcaaccagaaacatcaaggcc
ggagaagaacttacatttgattaccaaatgaaaggttctggggactttagcacagattct
attgatatgagccctgccaagaaaagagtgaggatagcttgcaaatgtggagctgccacc
tgccgtggataccttaattaa

DBGET integrated database retrieval system