KEGG   Xenopus tropicalis (western clawed frog): 549513Help
Entry
549513            CDS       T01011                                 

Gene name
cdc23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    549513 (cdc23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    549513 (cdc23)
   04114 Oocyte meiosis
    549513 (cdc23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    549513 (cdc23)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     549513 (cdc23)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    549513 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
LinkDB All DBs
Position
3
AA seq 581 aa AA seqDB search
MAATSGMFSDLKEIKKQLLSVTWLCRERGLMHSVKWASELAFSLESIPLNELPSTPALTE
EDAQDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVKNEALRELRVELSKKHKARELDGFGLYLYGVVLRKLDLAKEALDVFVEATHV
LPLHWGTWLELCNLITDKEMLKFLSLPESWIKEFFLAHIYTELQLIEEALQKYQSLIDAG
FSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRGLKPELSY
LAHNLCDIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVA
LGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIY
SCGEIVEHQELSTAFRYLAQYYFKCKLWDEASACAQKCFNFNDTREEGKALLRQILQLRN
QNESPSADLPATAPFFLPQSLSANNTPTRRVSPLNLSSVTP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacaagcgggatgttttctgatttgaaggaaatcaagaaacagctgctaagc
gtaacctggctttgccgggagagaggtctgatgcatagcgtcaaatgggcatcagaactt
gctttctctctggaatctattcctttaaatgagcttccttcaaccccagcacttacagag
gaggatgcccaggatctggatgcatatacactggctaagtcttactttgacctaaaagaa
tatgatcgagctgcatattttcttcgggggtgtaagagccagaaagcctatttcttgtac
atgtactccaggtacttgtctggagaaaagaagaaggatgatgaaacagttgatagcctt
ggtccccttgaaaaagggcaggtaaagaatgaggctctgagggaactacgtgtggagctg
agtaagaagcacaaagccagggaattagatggatttggactgtacttgtatggagtggtc
ttgaggaagctggatctggcaaaagaagcgttagatgtatttgtggaggcaacacatgtt
ttgcccttacattggggaacctggctggagttatgtaatttgattacagacaaagagatg
ctgaagttcctgtccctgccagaatcatggataaaggaatttttcttggcacacatatat
acagagctgcagttgattgaggaagcattgcagaaataccaaagtcttattgatgctggc
ttttccaagagtacttacattatttctcaaattgctgttgcctaccataacatccgagat
attgacaaagctctgtctatattcaatgagctgcggaaacaggatccttacagaatagaa
aacatggacaccttttccaacctcctgtatgtcaggggtctgaaaccagaattaagctat
ttggcccacaatctatgtgacattgacaagtaccgtgttgagacctgttgcgttatcggc
aattattacagcttgcgctcccagcatgaaaaagcagcgctgtacttccaaagggcacta
aaactcaaccctcgatatcttggtgcttggaccctcatgggccatgaatacatggaaatg
aagaacacttctgcagcaatacaggcttacaggcatgcaattgaagtgaacaagagagat
tatcgtgcttggtatggattaggacaaacctatgaaatattaaagatgccattttactgc
ctttattattatagacgggcccatcagctcagacccaatgactctagaatgcttgttgct
ttgggggaatgttatgaaaagcttaatcaacttgtggaggctaaaaaatgttactggaga
gcttatgctgtaggtgatgttgagaaaatggctctggtcaagctggcaaagcttcatgaa
caactgaatgaatcagaacaggctgcccagtgttacatcaaatacatacaggacatctac
tcctgtggggaaattgtagagcaccaggagctcagcacagcctttcgctatctggctcag
tattactttaagtgcaagctgtgggatgaagcatctgcatgtgcccagaaatgcttcaat
tttaatgataccagggaagaagggaaagctcttctacggcaaattctacaattaaggaac
cagaatgaaagtccatcagctgacctcccagccactgctccattctttcttccgcaatct
ctttcagccaacaacacccctacaagacgagtgtctccacttaacctgtcatctgttaca
ccttag

DBGET integrated database retrieval system