KEGG   Xanthomonas vesicatoria: BJD12_11905Help
Entry
BJD12_11905       CDS       T04741                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xve  Xanthomonas vesicatoria
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xve00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BJD12_11905
  Lipid metabolism
   00600 Sphingolipid metabolism
    BJD12_11905
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BJD12_11905
Enzymes [BR:xve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BJD12_11905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2738264..2741014)
Genome map
AA seq 916 aa AA seqDB search
MRQQHVRRALSAGLVALVCIVSAAAVADAAAATPGSAPRERVSLDAGWRFQRGDPPGNTA
ELDYDVRPEVVRSEDGKVADARPDQAQQPQVSSTAVLKPWILPTANALIADPAQRHRRPP
GNPGSNVAYVQTGFDDSRWQPVDLPHDWAIAGPFLADGPYGGMGRLASWGVGWYRKTLDI
PASDRGRSLFLDLDGAMSYATVWLNGTLVGGWPYGYSSWRVDLTPYAIAGARNQLAIRLD
NPPDSARWYPGGGLYRHVWLTKTAPLHIAQWGTQLTTPQVSKASAQVQLAVTLDNAAHTP
AQAQVSTAIYVLDPARDTPGGEAVAQIPATQIAVPAGGSARVQGTVQIESPQLWGPPPTQ
QPHRYVAVTEVRQNGQLVDRYSTPFGIRGIVFDADRGLLVNGEHVPIRGVNNHHDLGALG
AAFNVRAAERQLQLLQQMGANAIRMSHNPPAPELLELTDRMGLLVVDEVFDSWEMKKTPL
DFHLVFAQWHEPDLRAMLRRDRNHPSVVVWSVGNEVGEQYTGEQGAAIARKLHAIVHDED
PSRPATAAMNYASPDMPLPAALDVISLNYQGEGIRDTPEFEGTERIRKQPQYPAFHAKFP
HKAILSSETASALSSRGVYLFPVSPDTSAPVREGRGGDAVAHQVSAYELHAVDFGSSADK
VFAALDRHPYVAGEFVWTGFDYLGEPTPYYSSRSSYSGILDLAGFPKDRYWLYQARWRPE
LPMAHLLPHWSWPGREGQVSPVHVFTSGDEAELFVNGISQGRKRKGALQYRLRWDDVRYQ
PGELRVQAYKDGRPWASDRVQTAGRAARMQLTPDRSRIDGDGRDLSFVTVRLLDRDGRPA
PTAGDRLRFRIDGPGELVATDNGDPTNLESFGASQRNAFNGLCLAIVRAKAGARGTITLH
VESDSLDAAQAQIVAQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgcggcagcagcacgtccggcgcgctctgagtgcgggcctggtcgcgcttgtctgcatc
gtcagtgcagcagcggtagcagatgcagcggcagcaacgccaggcagcgcgccgcgcgag
cgggtgtcgctggacgcgggctggcgtttccagcgcggtgatccgccgggtaacaccgcg
gagctcgattacgacgtgcgcccggaggtcgttcgcagcgaggatggcaaggtggccgac
gcgcgcccggatcaggcgcagcaaccgcaggtatcgtcgaccgcggtgctcaagccgtgg
atcctgccaaccgccaacgcactcattgccgacccggcgcaacggcatcgacgcccaccc
ggcaatcccggcagcaacgtcgcgtatgtacagacaggcttcgacgacagccgctggcaa
ccggtggacctgccgcacgactgggccatcgccgggccgttccttgccgatggtccgtac
ggcggcatgggccggctggcgagctggggtgtgggctggtatcgcaagacgctggatatc
cctgccagcgaccgcggccgctcgctgtttctcgatctcgatggcgcgatgtcctatgcc
acggtctggctcaacggcacgctggtcggcggctggccatacggctacagctcctggcgc
gtggatctgacgccgtatgcgattgccggtgcgcgcaaccagctggcgatccgtctggac
aatccacccgactcggcgcgctggtaccccggtggcgggctgtatcgccatgtgtggctg
accaagaccgcgccgctgcatatcgcccagtggggcacgcaattgaccacgccccaggtg
tcgaaggcatccgcacaggtgcagttggctgtgacgctggacaacgctgcgcatacccca
gcgcaagcgcaggtcagcacggccatctatgtgctcgacccagcaagggatacgcctggc
ggcgaagcggtcgcgcagatccccgcaacgcagattgcggtgcccgccggcggcagtgcc
cgcgtgcagggcaccgtgcaaatcgagagcccgcaactatggggaccaccgcccacccag
cagccgcatcgctacgtggcggtgaccgaggtgcgccagaacggccaactggtggaccgc
tacagcaccccgttcggcatccgcggcatcgtgttcgatgccgacaggggcctgctggtc
aacggcgagcacgtgccgattcgcggggtcaacaaccatcacgacctcggcgcgctcggt
gccgcgttcaatgtgcgtgccgccgagcgccagctgcagttgctgcaacagatgggcgcc
aatgccatccgcatgagccacaacccgcctgcgccggagctgctggaactcaccgaccgc
atgggcctgctggtggtggacgaggtgttcgacagttgggagatgaagaagacgccattg
gatttccatctggtgtttgcgcaatggcacgagccggatctgcgcgcgatgttgcggcgc
gaccgcaaccatccgtcggtggtggtgtggagcgtgggcaatgaagtcggcgagcaatac
accggcgagcagggtgcggcaatcgcgcgcaagctgcatgccatcgtgcacgacgaagat
cccagccgcccggccacggcggcgatgaactacgcctcgcccgacatgccgttaccggct
gcgctggatgtcatcagtctcaattaccagggcgagggcattcgcgatacgcctgagttc
gagggcaccgagcgcattcgcaagcaaccgcaatatccggcattccatgcgaagtttccg
cacaaggcgatcctcagcagcgaaaccgcctcggcattgagcagccgcggggtgtatctg
tttccggtgagcccggacaccagcgcaccggtgcgcgaggggcgcggcggcgatgcggtg
gcgcatcaggtcagcgcctatgagttgcatgcagtggacttcggttccagtgcggacaag
gtgttcgccgcgttggaccggcacccgtacgtggccggcgaattcgtctggaccggcttc
gattacctgggcgagcccacgccgtattacagctcgcgcagctcctattcgggcatcctg
gatctggcggggtttcccaaggatcgctactggctgtatcaggcgcggtggcgcccggaa
ctgcccatggcgcatctgctgccgcactggagctggcccggccgcgagggccaggtgtcg
ccggtgcatgtgttcacctccggcgacgaggccgagctgttcgtcaacggcatctcgcag
gggcgcaagcgcaagggcgcgctgcagtaccggttgcgctgggacgatgtgcgctatcag
cccggcgagctgcgcgtgcaggcgtacaaggacggcaggccgtgggccagcgatcgcgtg
cagacggccggccgcgcggcgcgcatgcagctcacgccagaccgcagccgcatcgacggc
gatggccgggatctgagctttgtcaccgtgcggctgctggatcgcgatggacgtcctgcg
cccactgccggcgaccgcctgcggtttcgcatcgatggtcctggcgagctggtcgccacc
gacaacggcgaccccaccaatctggagtcgttcggcgcgtcgcaacgcaacgccttcaat
gggctgtgcctggcgatcgtgcgggccaaggcgggcgcacgcggcaccatcacgctgcat
gtcgaatcggatagcctggatgccgcgcaggcgcagatcgtggcgcagtga

DBGET integrated database retrieval system