KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_02691Help
Entry
YE5303_02691      CDS       T03739                                 

Gene name
gadA
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Pathway
yee00250  Alanine, aspartate and glutamate metabolism
yee00410  beta-Alanine metabolism
yee00430  Taurine and hypotaurine metabolism
yee00650  Butanoate metabolism
yee01100  Metabolic pathways
yee01110  Biosynthesis of secondary metabolites
yee01120  Microbial metabolism in diverse environments
yee02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yee00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    YE5303_02691 (gadA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YE5303_02691 (gadA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YE5303_02691 (gadA)
   00430 Taurine and hypotaurine metabolism
    YE5303_02691 (gadA)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    YE5303_02691 (gadA)
Enzymes [BR:yee01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     YE5303_02691 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CCQ38979
LinkDB All DBs
Position
642888..644288
Genome map
AA seq 466 aa AA seqDB search
MTRKSLDDYRSDLLDSRFGSKAIRNISENKVFPKEEMREDIAFQIISDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMMADLWNAPTPKGAQGVG
TNTIGSSEACMLGGMAMKWRWRKKMAAAGKPTNKPNFVCGPVQVCWHKFARYWDVEIREI
PMIPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYELPKPLHDALDKLQKDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQVGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEFLAKEIAPL
GPYEFYCSGGPYEGIPAICFRIKKGAKAGYTLYDLSERLRLRGWQVPAFTLSGKMSDVVV
MRIMCRRGFEMDFAGLLLDDFKSSLKYLSEHPSLGGEASQNSFSHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaaatctctggatgattatcgctcagatttattagactctcgctttggctct
aaagcgattcgtaatatttcagaaaataaagtgttccctaaagaggagatgcgcgaggat
attgcttttcaaatcatcagtgatgagctatttcttgatggtaatgcgcgacaaaacctc
gcgacattctgtcagacgtgggatgacgataatgtccataaactgatggatctttcaata
aataaaaactggattgataaagaggaatatccgcaatcagcggcaatagatatgcgctgc
gtaaatatgatggctgatttgtggaatgccccaacaccaaagggggcacaaggggtaggg
acgaataccattggttcgtcagaagcttgtatgctgggtggtatggcgatgaagtggcgc
tggcgtaaaaaaatggcagcggcaggtaaacccaccaataaacctaattttgtctgtggg
ccagtacaagtttgttggcataaatttgctcgttattgggatgtggaaattcgagaaatt
cctatgattccagggcaattatttatggacccgcagcggatgatagaggcctgtgacgaa
aataccattggtgtagtgccgacttttggtgtgacttacaccggcaattatgaattaccc
aaacccttgcatgacgcgctggataaactgcaaaaagatactggcctcgatattgatatg
catattgatgcggcgagtggcggctttttagctccctttgttgcgccggatattgagtgg
gacttccgcttgccacgggttaaatcaatcagcacttctgggcataaattcggacttgct
cctttgggatgtggttgggttatttggcgtgatgctgccgctttacctgaagagctgata
tttaatgtcgattatcttggcgggcaggtcggcacatttgctatcaacttctcgcgtccg
gcggggcaagttatttcccaatattatgaatttatacgcctagggcgtgaaggttatacc
aaagtacaaagcgcctgctatcaggtagctgaattcctcgccaaagaaatagccccgctt
gggccttatgaattctattgcagcggcggcccatacgagggcattccagcgatttgtttc
cgcatcaaaaaaggagccaaggcggggtataccctctacgacctctccgagcgtttaaga
ttgcgtggctggcaggttccggcatttacccttagtggcaaaatgtcagatgtggtagtt
atgcgcatcatgtgccgccgtgggttcgagatggatttcgccgggctgctgttggatgat
tttaaatcctcactgaaatacctgagtgaacatccatcccttggaggcgaggcaagtcag
aatagttttagccatacataa

DBGET integrated database retrieval system