KEGG   Yersinia enterocolitica (type O 5) YE53/03: YE5303_43611Help
Entry
YE5303_43611      CDS       T03739                                 

Gene name
tufA
Definition
(GenBank) elongation factor TU
  KO
K02358  
elongation factor Tu
Organism
yee  Yersinia enterocolitica (type O:5) YE53/03
Brite
Translation factors [BR:yee03012]
 Eukaryotic Type
  Elongation factors
   YE5303_43611 (tufA)
 Prokaryotic Type
   YE5303_43611 (tufA)
Mitochondrial biogenesis [BR:yee03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YE5303_43611 (tufA)
Exosome [BR:yee04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YE5303_43611 (tufA)
  Exosomal proteins of breast cancer cells
   YE5303_43611 (tufA)
  Exosomal proteins of colorectal cancer cells
   YE5303_43611 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
330577..331761
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRDLLSTYDFPGDDTPVVRGSALKALE
GEPEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGLKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMI
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaatgtgggtactatcggccac
gttgaccatggtaaaactaccctaactgctgcaatcaccaccgttctggctaaaacctac
ggcggaaatgctcgtgcattcgaccaaattgacaacgctcctgaagagaaggcgcgtggt
atcaccatcaacacgtctcatgttgaatatgacaccccgtcacgtcactatgcgcacgtt
gactgcccagggcacgccgactacgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgattctggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggcgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgacgatgaagagctgttagaactggtagaaatggaagtgcgcgatcttctgtctacc
tacgatttcccaggcgatgatacgccggttgttcgtggttcagcgctgaaagcattggaa
ggcgaacctgagtgggaagcaaaaattatcgaactggctggctacctggattcttacatc
ccagaaccagagcgtgctatcgataagccgttcctgctgccaatcgaagacgtattctct
atatctggccgtggtaccgttgtaacgggtcgtgtagagcgcggtattgttaaagttggc
gaagaagtcgaaattgttggcctgaaagataccgttaaatctacttgtaccggcgttgaa
atgttccgcaaattgctggacgaaggccgtgcaggtgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagatatcgaacgtggtcaagttcttgctaaaccaggttctattaag
ccacacaccaaatttgaatcagaagtttatattctgagcaaagatgaaggtggtcgccat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgatgtaaccggt
actattgaactgccagaaggcgttgagatggtgatgccaggtgataacattcaaatgatt
gttaacctgattgctcctatcgcaatggatgacggcttgcgcttcgcaattcgtgaaggc
ggtcgtactgtaggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system