KEGG   Yersinia enterocolitica FORC_002: FORC2_0188Help
Entry
FORC2_0188        CDS       T03890                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
yef00564  Glycerophospholipid metabolism
yef01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yef00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    FORC2_0188
Enzymes [BR:yef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FORC2_0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AKF36335
UniProt: A0A0E8LJ47
LinkDB All DBs
Position
complement(242664..244178)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDANTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKDVKIDDQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYTNVGPAWTKTGSLPGGDIGGNRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILADATSIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMMLDEA
QKQRISQWLAEAQAEKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgcg
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgtgct
acatcttctgccagctccaaactgatccacggtggcttacgttacctggaacactatgaa
ttccggttggtcagtgaagcattggccgaacgtgaggttttgctgaaactggctcctcat
atcgctttcccaatgcgctttcgcctgccccatcagccccatctgcgcccggcgtggatg
attcgtaccggcttattcttgtacgatcatttgggcaaacgtaccagcttgccagccagt
aaagggctacgctttggacccgaatcagtattaaagcccgagttagtgcgcggtttcgaa
tattctgactgctgggtagatgatgcccgtctggtcgtgctgaatgctcaggaagtggtc
gaacgtggcggcgaagtacgtactcgcaccaaagtgactcgcgcctggcgtgaacaaggc
ctatggatggtggaagcggtcgatgccaacaccggcaaaacctttacctggcgcgctaaa
gggttagtcaatgctaccggcccgtgggttaaacagttcttcgatgatggtctgaaactg
aaatcaccttatggcatccgcctgatcaaaggtagccatattgtggtgccacgggttcat
aaccagccacaagcctatattctgcaaaacgaagaccatcggattgtcttcgtcattcct
tggttggatgaatattccatcatcggtaccacagacgtcgaataccacggcgatccgaaa
gatgtgaagatcgacgaccaggaaattgattacctgctgaaggtctataacgaccacttt
aaaaagcaactgggccgcgatgatatcgtctggacttactctggcgttcgtccgctgtgt
gatgatgaatcagattcaccgcaagcggttacccgcgattacacactggatgtcgccgat
gaaggcggcaaagcaccgctgctgtcagtatttggtggcaaactgaccacctaccgcaaa
ttggcagaacatgcgctggaaaaactgtccggctactataccaatgtcggcccggcatgg
acaaaaaccggctcgttaccgggcggggatattggcggcaaccgtgataactacacggta
caactgcgccatcgctataactggctacctgaagggttggcgcgccgctatacccgtacc
tatggcagtcatagcgagctgattttggctgatgccaccagcatagaaagcttgggcgaa
cacttcggccacggtctgtatgaagcagaattgcgctatctggttgaaaaagagtgggtt
gttgaactcgatgatgccatctggcgtcgcaccaagttaggcatgatgctagacgaggca
caaaaacaacggatttctcagtggctggcagaagcgcaggctgagaaacaacagactctt
tccttggtctcctga

DBGET integrated database retrieval system