KEGG   Yersinia enterocolitica FORC_002: FORC2_0526Help
Entry
FORC2_0526        CDS       T03890                                 

Definition
(GenBank) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
yef  Yersinia enterocolitica FORC_002
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yef00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FORC2_0526
   00220 Arginine biosynthesis
    FORC2_0526
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FORC2_0526
Enzymes [BR:yef01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     FORC2_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
608933..609874
Genome map
AA seq 313 aa AA seqDB search
MTIDLARLNQVVKDSYSQYSTLAGGENASYIPYLASVPSQLAGLAIVTIDGDIISQGDAD
FRFALESISKVCSLALALEDIGPQAVQDKIGADPTGLPFNSVIALELHNGKPLSPLVNAG
AMSTVSAIKASNREDRWARILDMQQQLVGAPIALSDEVNHSEQTTNFHNRAIAWLLYSAQ
AMYCDPMEACDVYTRQCSTLLNTIELATMGATFAAAGVNPVTKKQVLTASNTPFILAEMT
MEGMYGSSGDWAYTVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDPVGNSVRGQKMVASV
AQHLGYNLYKGSL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgactattgacctagctcgtctgaatcaagttgttaaggatagttattcacaatattcc
accctcgccggaggagagaatgccagctatattccttatctggccagtgttcccagtcag
cttgctgggttggccattgtcacgattgatggcgatattatttcgcaaggtgatgccgat
tttcgttttgccttggaatctatttcgaaagtgtgctctcttgccttagcgctagaagat
attggcccgcaagctgtgcaagacaagataggcgcagatcctaccggtttaccttttaac
tcggtcattgcgttggagctgcacaatggtaagcccttgtcgccattggtcaatgcggga
gcaatgtcgacagtaagtgcgattaaggccagtaatagagaggatcgctgggcacggatt
ctggacatgcaacagcaactggttggtgcgccgattgcactttcggatgaagttaaccat
tcagaacaaaccaccaattttcacaatcgcgccattgcatggctgctttattcggctcag
gccatgtattgcgacccgatggaggcttgtgacgtatacactcgtcagtgttcaacattg
ctcaatactattgaactggccacgatgggtgcaacctttgcggcggcgggagttaatcct
gtgactaaaaagcaggtgctgacggccagcaatacgccatttattttggctgaaatgacc
atggaagggatgtatggcagctctggagattgggcatatactgtgggtttaccgggtaaa
agtggtgtcggtggtggcatcctggcggtagtgccgggtgttatggggattgcggcattt
tcgccgcctcttgacccggtaggcaatagtgtacgcggtcaaaaaatggtggcatcagtg
gcgcaacatttgggatataacctatataaaggttcgctttaa

DBGET integrated database retrieval system