KEGG   Yersinia enterocolitica FORC_002: FORC2_3826Help
Entry
FORC2_3826        CDS       T03890                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
yef  Yersinia enterocolitica FORC_002
Brite
Translation factors [BR:yef03012]
 Eukaryotic Type
  Elongation factors
   FORC2_3826
 Prokaryotic Type
   FORC2_3826
Mitochondrial biogenesis [BR:yef03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    FORC2_3826
Exosome [BR:yef04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FORC2_3826
  Exosomal proteins of breast cancer cells
   FORC2_3826
  Exosomal proteins of colorectal cancer cells
   FORC2_3826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4363071..4364255)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRDLLSTYDFPGDDTPVVRGSALKALE
GEPEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGLKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMI
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaatgtgggtactatcggccac
gttgaccatggtaaaactaccctaactgctgcaatcaccaccgttctggctaaaacctac
ggcggaaatgctcgtgcattcgaccaaattgacaacgctcctgaagagaaggcgcgtggt
atcaccatcaacacgtctcatgttgaatatgacaccccgtcacgtcactatgcgcacgtt
gactgcccagggcacgccgactacgttaaaaacatgatcaccggtgctgctcagatggac
ggcgcgattctggttgttgctgcaactgatggcccaatgccacagactcgtgagcacatc
ctgttgggtcgtcaggttggcgttccttacatcatcgtattcatgaacaaatgtgacatg
gttgacgatgaagagctgttagaactggtagaaatggaagtgcgcgatcttctgtctacc
tacgatttcccaggcgatgatacgccggttgttcgtggttcagcgctgaaagcattggaa
ggcgaacctgagtgggaagcaaaaattatcgaactggctggctacctggattcttacatc
ccagaaccagagcgtgctatcgataagccgttcctgctgccaatcgaagacgtattctct
atctctggccgtggtaccgttgtaacgggtcgtgtagagcgcggtattgttaaagttggc
gaagaagtcgaaattgttggcctgaaagataccgttaaatctacttgtaccggcgttgaa
atgttccgcaaattgctggacgaaggccgtgcaggtgagaacgttggtgttctgctgcgc
ggtatcaagcgcgaagatatcgaacgtggtcaggttcttgctaaaccaggttctattaaa
ccacacaccaaatttgaatcagaagtttatattctgagcaaagatgaaggtggtcgccat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgatgtaaccggt
actattgaactgccagaaggcgttgagatggtgatgccaggtgataacattcaaatgatt
gttaacctgattgctcctatcgcaatggatgacggcttgcgcttcgcaattcgtgaaggc
ggtcgtactgtaggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system