KEGG   Yersinia enterocolitica LC20: LC20_00859Help
Entry
LC20_00859        CDS       T03179                                 

Definition
(GenBank) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
yel  Yersinia enterocolitica LC20
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yel00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LC20_00859
   00220 Arginine biosynthesis
    LC20_00859
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LC20_00859
Enzymes [BR:yel01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LC20_00859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(773932..774870)
Genome map
AA seq 312 aa AA seqDB search
MTIDLARLNQVVKDAYSQYSTLAGGENASYIPYLASVPSQLAAVAIVTVDGDIISQGDAD
FRFALESISKVCSLALALEDIGPQAVQDKIGADPTGLPFNSVIALELHNGKPLSPLVNAG
AMSTVSAIKASSREERWARILDMQQQLVGAPIALSDEVNHSEQTTNFHNRAIAWLLYSAQ
TMYCDPMEACDVYTRQCSTLLNTIELATMGATFAAGGINPVTKKRVLTATNTPFILAEMT
MEGLYGSSGDWAYTVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDPVGNSVRGQKMVASV
AQQLGYNLYKSR
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactattgacctagctcgcctgaaccaagttgttaaggatgcatattcgcaatattcc
accctcgctggaggggagaatgccagctacattccctatctggccagtgttcccagccag
ttggccgcggtggccattgtcactgttgatggcgatattatttcgcaaggtgatgctgat
tttcgctttgccttggagtccatttcgaaagtgtgctctctggctctggcattagaggat
attggcccgcaagcagtgcaagacaaaatcggtgcagatccgacgggtttgccgtttaac
tcggtgattgccttggaactgcataatggtaagccattgtcaccgctggtgaatgcgggg
gcgatgtcgacagtgagtgcgattaaagctagcagccgggaggagcgctgggcgcgtatt
ctggatatgcaacaacagttagtaggagcgccgattgcactgtcggatgaggttaatcat
tccgaacaaacgaccaattttcacaatcgggcgattgcatggctgctttattcggctcaa
accatgtattgcgatcctatggaggcctgtgatgtttatacccgtcagtgctcaacattg
ctcaataccattgaactggccaccatgggggcaacgtttgctgcaggcggcataaatcct
gtgactaaaaaacgggtattaaccgccaccaatacgccgtttattttggctgaaatgacc
atggaggggctgtatggtagttcgggcgactgggcatataccgtagggttgccggggaaa
agtggtgtgggtgggggaatattggcggtggttccgggtgtcatggggattgcggccttt
tcaccgccacttgacccggttggcaatagtgtccgtgggcaaaaaatggtggcgtcggtg
gctcagcagttaggatataacttatataaaagccgttag

DBGET integrated database retrieval system