KEGG   Yersinia enterocolitica subsp. enterocolitica 8081: YE4008Help
Entry
YE4008            CDS       T00469                                 

Gene name
glpD
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yen  Yersinia enterocolitica subsp. enterocolitica 8081
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yen00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YE4008 (glpD)
Enzymes [BR:yen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YE4008 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4358593..4360107
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDANTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKDVKIDDQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNVGPAWTKTGSLPGGDIGGSRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILADATSIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMTLDDV
QKQRVAEWLAQVQAEKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgcg
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgtgct
acgtcttctgccagctccaaacttatccacggtggtttacgttacctggaacactatgaa
ttccggttggtcagtgaagcattggccgaacgtgaggttttgctgaaactggctcctcat
atcgctttcccaatgcgctttcgcctgccccatcagccccatctgcgcccggcgtggatg
attcgtaccggcttattcttgtacgatcatttgggcaaacgtaccagcctgcccgccagt
aaagggctacgctttggacccgaatcagtattgaagcccgagttagtgcgcggtttcgaa
tattctgactgctgggtcgatgatgcccgcctggtagtgctgaatgctcaggaagtggtc
gaacgtggcggcgaagtacgtactcgcaccaaagtgactcgcgcctggcgtgaacaaggc
ctatggatggtggaagcggtcgatgccaacaccggcaaaacctttacctggcgtgctaaa
ggcttggtgaatgccaccggcccatgggttaaacagttctttgatgatggtctgaaactg
aaatcaccttatggtatccgcctgatcaaaggtagccatattgtggtgccacgggttcat
aaccaaccacaagcctatattctgcaaaacgaagaccaccgtattgtcttcgtcattcct
tggttggatgaatattccatcatcggtaccactgatgtggaataccacggcgatccgaaa
gatgtgaagatcgacgatcaggaaattgattacctgctgaaggtgtataacgaccacttt
aaaaagcaactgggccgcgacgatatcgtctggacttactctggcgttcgtccgttgtgt
gatgatgaatcagattcaccgcaagcggttacccgtgattacacactggatgtcgccgat
gaaggcggcaaagcaccactgctatcagtatttggtggcaaactgaccacttaccgcaag
ctggcagaacatgcgctggaaaaactgtccggctactatccaaatgtcggcccggcatgg
acgaaaaccggctcgttaccgggcggggatattggtggcagccgtgataactataccgtg
caattacgccatcgctataactggctacctgaagggctggcgcgccgctatacccgtacc
tatggcagtcatagcgagctgattttggctgatgccaccagcatcgaaagcttgggcgaa
cacttcggccacggtctatatgaagcagaattgcgctatctggttgaaaaagagtgggtg
gttgaacttgatgatgcaatctggcgtcgcactaagttaggcatgactctggatgatgtg
cagaaacagcgagtggctgaatggctggcgcaagtacaagctgagaaacaacagaccctg
tctttggtctcctga

DBGET integrated database retrieval system