KEGG   Yersinia enterocolitica 2516-87: CH48_3956Help
Entry
CH48_3956         CDS       T03644                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
yet  Yersinia enterocolitica 2516-87
Pathway
yet00010  Glycolysis / Gluconeogenesis
yet01100  Metabolic pathways
yet01110  Biosynthesis of secondary metabolites
yet01120  Microbial metabolism in diverse environments
yet01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:yet00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CH48_3956
Enzymes [BR:yet01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CH48_3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AJJ26976
UniProt: A0A0E1NEZ2
LinkDB All DBs
Position
4330981..4331859
Genome map
AA seq 292 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPIVVVSHPKVRAAVSLQGAHLLAFQPSGEQPIIW
LSNNTPFKEGIAIRGGVPICWPWFGPSAQPSHGFARLLPWKLSAHDENENGVILTFTLED
SDASRQFWPHPFTLIARFKLGEECEMELESHGEYEAVAALHTYFQIGNISQIKISGLGEK
YLDKVLKIADATQQGDLVFNGQTDRIYTHPETYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSSSMVDMPNDGYKTMVCVETARVNKPLVAKQDSPARLAMTIRSRKNTQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtcttcaccctacctgttgttgaacaaatttcaccttatatcagccag
cgccagttggatgaactgccaatcgtagtggtttcccatccgaaggtacgtgccgccgtc
agcttgcaaggtgctcatttattggctttccaaccgagtggtgagcaaccgattatttgg
ttaagtaataacacaccatttaaagaaggtatcgctattcgtggtggtgtaccgatctgt
tggccttggtttggcccatcagcgcaaccttctcatggttttgctcgtttactgccatgg
aagctcagcgctcatgatgaaaatgagaatggggttatcttgaccttcactctggaagac
agcgatgcatctcgtcaattctggccacacccgttcactttgattgcccgcttcaagctg
ggcgaagaatgtgagatggaattagaatcacacggtgagtacgaggcagttgctgccttg
cacacttatttccagattggcaatatcagccagattaagatcagtggcctgggcgaaaag
taccttgataaagtgctgaaaattgctgatgcaacgcaacaaggtgacttggtctttaac
ggtcagactgaccgcatctatacccaccctgaaacctacagcctgataaaagatgccgcg
ctgaaacgtaccattgaagtgcatcaccatcatcaaagtgacgtagttgcgtggaatcca
ggagctgaactgtccagcagcatggttgatatgccaaatgatggatataaaacaatggtt
tgtgtagaaactgcgcgggtgaataaaccgttggttgccaaacaagattcccctgcacgt
ctggccatgactattcgtagtcgcaagaatacccaataa

DBGET integrated database retrieval system