KEGG   Yersinia enterocolitica subsp. palearctica Y11: Y11_31891Help
Entry
Y11_31891         CDS       T02010                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yey  Yersinia enterocolitica subsp. palearctica Y11
Pathway
yey00564  Glycerophospholipid metabolism
yey01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yey00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Y11_31891
Enzymes [BR:yey01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Y11_31891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: CBY29341
UniProt: A0A0H3NXJ3
LinkDB All DBs
Position
complement(3311923..3313437)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAVDANTGKIFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKDVKIDDQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEGGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNVGPAWTKTGSLPGGDIGGSRDNYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILADATSIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMTLDDV
QKQRVAEWLAQVQAEKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgcg
gacgctgcagggcgtggcctgtccgttctgctgctggaagcacaagatttggcctgtgct
acgtcttctgccagctccaaacttatccacggtggtttacgttacctggaacactatgaa
ttccggttggtcagtgaagcattggccgaacgtgaggttttgctgaaactggctcctcat
atcgctttcccaatgcgctttcgcctgccccatcagccccatctgcgcccagcgtggatg
attcgtaccggcttattcttgtacgatcatttgggcaaacgtaccagcctgcctgccagt
aaagggctgcgctttggacccgaatcagtattgaagcccgagttagtgcgcggtttcgaa
tattctgattgctgggtagatgatgcccgcctggtagtgctgaatgctcaggaagtggtc
gaacgtggcggcgaagtacgtactcgcaccaaagtgactcgcgcctggcgtgaacaaggc
ctatggatggtggaagcggtcgatgccaacaccggcaaaatctttacctggcgcgccaaa
gggttagtcaatgctaccggcccgtgggttaaacagttctttgatgatggtctgaaactg
aaatcaccttatggtatccgcctgatcaaaggtagccatattgtggtgccacgggttcat
aaccaaccacaagcctatattctgcaaaacgaagaccaccgtattgtcttcgtcattcct
tggttggatgaatattccatcatcggtaccactgatgtggaataccacggcgatccgaaa
gatgtgaagatcgacgatcaggaaattgattacctgctgaaggtctataacgaccacttt
aaaaagcaactgggccgcgacgatatcgtctggacttactctggcgttcgtccgctgtgt
gatgatgaatcagattcaccgcaagcggttacccgtgattacacactggatgtcgccgat
gaaggtggcaaagcaccactgctatcagtatttggcggcaaactgaccacttaccgcaag
ctggcagaacatgcactggaaaaactgtccggctactatccaaatgtcggcccggcatgg
acgaaaaccggctcgttaccgggcggggatattggtggcagccgtgataactataccgtg
caattacgccatcgctataactggctgcctgaagggctggcgcgccgctatacccgtacc
tatggcagtcatagcgagctgattttggctgatgccaccagcatcgaaagcttgggcgaa
cacttcggccacggtctgtatgaagcagaattacgctatctggttgaaaaagagtgggtg
gttgaacttgatgatgcaatctggcgtcgcactaagttaggcatgactctggatgatgtg
cagaaacagcgagtggccgaatggctggcgcaagtacaagctgagaaacagcagaccctg
tctttggtctcctga

DBGET integrated database retrieval system