KEGG   Yersinia frederiksenii: AW19_1544Help
Entry
AW19_1544         CDS       T03606                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yfr  Yersinia frederiksenii
Pathway
yfr00020  Citrate cycle (TCA cycle)
yfr00480  Glutathione metabolism
yfr01100  Metabolic pathways
yfr01110  Biosynthesis of secondary metabolites
yfr01120  Microbial metabolism in diverse environments
yfr01130  Biosynthesis of antibiotics
yfr01200  Carbon metabolism
yfr01210  2-Oxocarboxylic acid metabolism
yfr01230  Biosynthesis of amino acids
Module
yfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yfr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AW19_1544 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AW19_1544 (icd)
Enzymes [BR:yfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AW19_1544 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AJI87026
UniProt: A0A0B6FQ42
LinkDB All DBs
Position
complement(1653457..1654710)
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGNKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYKG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIREYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKDIIIKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMDGAKLLKCSEFGDAIIRHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtggttccggcagaaggtaataaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccatttattgaaggtgatggcattggcgtc
gatgtgaccccagccatgatcaacgtggtagatgctgcggttaagaaagcctataaaggt
gagcgtaaaatctcctggatggaaatctataccggtgagaaatcaactcatgtttatggc
aaagatgtttggctgccagaagaaacattggatctgattcgcgaatatcgcgttgctatt
aaaggtccattaaccacgccagtgggcggcggcattcgttctctgaacgttgctttgcgc
caacaactcgacttgtatgtgtgtctgcgcccagtgcgttattacgaggggacaccaagc
ccggtaaaacatcctgaattgaccaatatggtgattttccgcgaaaacgctgaagacatc
tatgcgggtattgaatggaaagcgggttcaccagaagctgaaaaagtgattaagttcctg
cgtgaagagatgggtgtgaagaaaatccgtttccctgaacaatgtggtattggtgtgaaa
ccttgttcagaagaagggactaagcgcttggttcgtgctgccattgagtacgcgattacc
aacgatcgtgaatcagtcactctggttcataaaggcaacattatgaaattcaccgaaggc
gcatttaaagactggggttaccagttagcgcgtgaggaatttggtggtgagctgatcgat
ggtggcccatgggttaaaattaagaatccaaacaacggtaaagacatcattattaaagat
gttattgccgatgctttcctacaacaaattttgctgcgcccagcggaatatgatgtcatc
gcctgtatgaacctgaacggcgattacatttctgatgccttggctgcacaagtcggcggt
atcggtattgctcctggcgctaacattggtgatgaatgcgccttgtttgaagcaacccac
ggcactgcaccaaagtatgcgggtcaggataaggtgaacccaggttctatcattctgtct
gcagaaatgatgctgcgtcatatgggctggttcgaagctgcagacctgattatcaaaggc
accgaaggcgctattcaggccaagacggtaacttatgatttcgaacgcttgatggacggc
gctaaactgttgaaatgtagtgaatttggcgacgccattattcgacatatgtaa

DBGET integrated database retrieval system