KEGG   Yersinia intermedia: CH53_1575Help
Entry
CH53_1575         CDS       T03608                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yin  Yersinia intermedia
Pathway
yin00564  Glycerophospholipid metabolism
yin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yin00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CH53_1575
Enzymes [BR:yin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CH53_1575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJJ17157
UniProt: A0A0T9MBM8
LinkDB All DBs
Position
1763169..1764683
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWVVEAIDVNTGKTFTCRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKEVKIDSQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEDGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYPNVGPAWTKTGALPGGDLGGSRDNYTVQLRHRYNWLPEGLARRYTHT
YGSHSELILAEATSIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMALDDA
QKQRIAQWLAQVQAGKQQTLSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggcattaatggtgccggtatcgctgct
gatgcggcagggcgtggcctgtccgttctgctgctggaagcgcaagacttggcctgtgct
acgtcttccgccagctccaaacttatccacggtggtctgcgctatctggaacactatgaa
ttccgtctggtaagtgaagcactggccgaacgtgaagtattattgaaactggcaccgcat
attgcgtttccaatgcgttttcgtttgccgcatcaaccccacctgcgcccagcctggatg
atccgcaccggtttgttcctgtacgatcacttgggcaaacgtaccagtttgcctgccagt
aaagggctgcgttttggaccagaatcggtattgaaaccagaattggtgcgcggtttcgaa
tattctgactgctgggtcgatgatgcccgtctggtggtgctgaatgcacaagaagtggtc
gagcgcggcggtgaagttcgcacccgtaccaaagtgactcgcgcctggcgtgaacaaggt
ctatgggtggttgaagccattgatgtgaatactggcaaaacctttacctgccgggccaaa
ggcttggtaaatgccaccggcccgtgggttaagcaattcttcgacgacggcctgaagctg
aaatcaccttatggcattcgcttgatcaaaggcagccatattgtcgtaccacgggttcat
aatcagccgcaggcctatattctgcaaaacgaagaccaccgtattgttttcgtcattccg
tggttagatgaatattccatcatcggcaccacagacgtggaataccacggtgatccgaaa
gaggtgaaaatcgactcacaagagatcgattacctgctgaaagtgtataacgatcacttt
aaaaaacagttgggtcgcgacgatatcgtgtggacctactcaggtgtgcgcccgctatgt
gacgatgaatcagattcaccacaagccgtcacccgcgactacacgttggatgtagccgat
gaagacggtaaagcgccactgctctctgtatttggcggcaaactgactacctatcgcaaa
ctggcagaacacgcgctggaaaaactgtctggctactatccgaatgttggcccggcatgg
accaagactggcgcgttaccgggcggggatcttggcggcagccgtgataactatactgtt
cagttgcgccatcgctataactggttacctgaagggttggcccgccgctatacccatacc
tatggtagccatagcgaactaattttggcagaagcgaccagtatcgaaagcttgggtgaa
catttcggccatggcttatacgaagcagaattgcgctatctggttgaaaaagaatgggtt
gttgaactggatgatgcaatttggcgccgtaccaagttaggtatggctctggacgatgca
cagaaacagcgcattgcccaatggctggcgcaagtacaggccgggaaacaacagacatta
tcgctggtttcctga

DBGET integrated database retrieval system