KEGG   Yersinia intermedia: CH53_46Help
Entry
CH53_46           CDS       T03608                                 

Gene name
glsA
Definition
(GenBank) glutaminase A
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
yin  Yersinia intermedia
Pathway
yin00220  Arginine biosynthesis
yin00250  Alanine, aspartate and glutamate metabolism
yin00471  D-Glutamine and D-glutamate metabolism
yin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yin00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH53_46 (glsA)
   00220 Arginine biosynthesis
    CH53_46 (glsA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CH53_46 (glsA)
Enzymes [BR:yin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     CH53_46 (glsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AJJ20445
UniProt: A0A0T9MVS2
LinkDB All DBs
Position
complement(50221..51159)
Genome map
AA seq 312 aa AA seqDB search
MTIDLARLNQVVKDVYSRYSTLAGGENASYIPYLASVPSQLAAVAIVTVDGDIISQGDAD
FRFALESISKVCSLALALEDIGPQAVQDKIGADPTGLPFNSVMALELHNGKPLSPLVNAG
AMSTVSAIKASSREERWARILDIQQQLAGAPIALSDEVNHSEQTTNFHNRAIAWLLYSAQ
AMYCDPMEACDVYTRQCSTLLNTIELATMGATFAAGGINPVTKKQVLTSSNTPFILAEMT
MEGMYGSSGDWAYTVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDPVGNSVRGQKMVASV
AQQLGYNLYKGH
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgactattgacctcgctcgtttgaatcaagtcgttaaggatgtctattcgcgctattcc
acactcgccggaggggagaatgccagctatattccctatctggcgagcgttcccagtcaa
ctggctgcggtggccattgtcactgttgatggcgatattatttcgcaaggtgatgctgat
ttccgctttgccctggagtcaatttcgaaagtgtgctctttagctctggcgttagaggat
attggcccacaggcagtacaagacaagataggtgcagatcccaccggtttaccttttaac
tctgtgatggcattggaactgcataacggtaagccattatcaccgctggtgaatgcgggg
gcgatgtccacggtcagtgcaattaaggccagcagtcgggaagagcgctgggcgcgtatt
ctggatattcaacagcagttagctggggcacccattgcgctttcggatgaagttaaccat
tcagagcaaaccaccaattttcacaaccgggccattgcctggttactttactcggctcag
gccatgtattgcgatcccatggaggcctgtgacgtctatacccggcagtgctcaacatta
ctcaataccattgaactggcaacgatgggggcaacctttgcggcagggggcatcaatcct
gtgaccaaaaagcaggtgctaacgtcttcaaatacgccgtttattttggctgaaatgacc
atggaggggatgtacggcagttcgggggattgggcgtataccgtagggttaccagggaaa
agcggtgtcggtggtggaatattggcggtagtgccaggtgttatgggcattgcggcattt
tcaccaccgcttgacccagtaggcaatagcgtccgtgggcaaaaaatggtggcatcggtg
gctcagcagttgggatataatttgtataaaggccattaa

DBGET integrated database retrieval system