KEGG   Yersinia intermedia: CH53_48Help
Entry
CH53_48           CDS       T03608                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yin  Yersinia intermedia
Pathway
yin00250  Alanine, aspartate and glutamate metabolism
yin00410  beta-Alanine metabolism
yin00430  Taurine and hypotaurine metabolism
yin00650  Butanoate metabolism
yin01100  Metabolic pathways
yin01110  Biosynthesis of secondary metabolites
yin01120  Microbial metabolism in diverse environments
yin02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yin00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CH53_48
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CH53_48
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CH53_48
   00430 Taurine and hypotaurine metabolism
    CH53_48
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    CH53_48
Enzymes [BR:yin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CH53_48
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJJ19136
LinkDB All DBs
Position
complement(52997..54397)
Genome map
AA seq 466 aa AA seqDB search
MSRKTTDDYRSTLLDSRFGSQAIRNISESKVFPKEEMREDIAFQIINDELFLDGNARQNL
ATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMMADLWNAPTPKGGQGVG
TNTIGSSEACMLGGMAMKWRWRKKMEAAGKPTNKPNFVCGPVQVCWHKFARYWDVEIREI
PMVPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYELPKPLHDALDKLQQDTGLDIDM
HIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDAAALPEELI
FNVDYLGGQVGTFAINFSRPAGQVISQYYEFIRLGREGYTKVQSACYQVAEYLAKEIAPL
GPYEFYCSGSPYEGIPAICFRIKEGAKAGYTLYDLSERLRLRGWQVPAFALNGEMSDVVV
MRIMCRRGFEMDFAGLLIDDFKSSLKYLSEHPSLGGEASQNSFNHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaaaaacgacagatgattatcgctcaacgttattagattctcgctttggttct
caagcgatccgtaatatctctgaaagtaaggtgttccctaaagaggaaatgcgtgaggat
attgcttttcaaattattaatgacgagctatttcttgatggtaatgcgcgacaaaacctt
gccacattctgtcagacgtgggatgacgataacgtccacaagttgatggacctttcgata
aataaaaactggattgataaagaggaatatccgcagtcggcggcgatagatatgcgctgt
gtcaacatgatggccgacttgtggaatgcccctacgccaaaaggtgggcaaggtgttggg
acgaataccatcggttcttcagaagcttgcatgctcggcggcatggccatgaagtggcgc
tggcgcaaaaaaatggaagcagcgggtaaaccgactaataagcctaattttgtctgtggc
ccggtacaagtgtgctggcataaatttgcccgttattgggatgttgaaatacgtgaaatt
cctatggttccggggcagttgtttatggatccacagcggatgatcgaggcatgcgatgaa
aataccatcggtgtcgtccccactttcggtgtgacttacaccggcaactatgagttacca
aaacccttacatgacgcactggataaactgcaacaggataccggccttgatattgatatg
catatcgatgcggcgagtgggggctttttagcgccgtttgttgcgcctgatatcgaatgg
gacttccgcttgccacgggttaaatcaatcagcacatccgggcataaattcggcttagca
cctttaggatgtgggtgggttatttggcgcgacgctgcggcgttacctgaagagttgatc
tttaatgtcgattacctcggcggtcaggttggcacttttgccattaacttctcgcgcccg
gcggggcaagttatttcccaatactatgaattcatacgcttggggcgtgaaggctatacc
aaggtacaaagcgcttgttatcaggtggcagaatacctggccaaagaaattgctccactg
gggccttatgaattctattgcagtggtagcccgtatgaaggcattcctgccatttgcttc
cgtatcaaagaaggggcgaaagcgggatataccttatatgacctttctgagcgcttgagg
ttacgcggctggcaagtgccggcatttgccctgaatggggagatgtctgatgtggtggtc
atgcgtatcatgtgccgtcgcggattcgagatggatttcgcagggttgttaatcgatgat
tttaaatcctcactgaaatacctgagtgagcatccatcccttgggggcgaggcgagtcag
aatagttttaaccatacctaa

DBGET integrated database retrieval system