KEGG   Yersinia kristensenii: CH54_2695Help
Entry
CH54_2695         CDS       T03609                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ykr  Yersinia kristensenii
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ykr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH54_2695
  Energy metabolism
   00680 Methane metabolism
    CH54_2695
Enzymes [BR:ykr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CH54_2695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2915574..2918309)
Genome map
AA seq 911 aa AA seqDB search
MELNAASGFVHLSLLGEINLHTHQVTKGTKRNHMNEQYSAMRSNVSMLGTLLGDTIKEAL
GEHILEKVETIRKLSKSSRAGNEASRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQ
YHSISPHGEAASNPEALAQLFTRLKDKKLSEKDMRSAVDELSIELVLTAHPTEITRRTLI
HKLVEVNTCLSQLDHNDLADYERNKIMRRLRQLVAQSWHTDEIRKIRPSPVDEAKWGFAV
VENSLWEGVPAFLREFNEQLQNSLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVL
LLSRWKATDLFLRDIQVLVSELSMSECTPELRELAGGEEVLEPYRELMKRMRTQLTNTQT
YLEGRLKGERVLPPTDLLVSNDQLWDPLYACYQSLKTCGMEIIANGQLLDTLRRVRCFGV
PLVRIDVRQESTRHTDAIAELTRYLGLGDYESWSEADKQAFLIRELNSKRPLVPLKWEPS
AETQEVLETCRVIAEAPQGSIAAYVISMAKVPSDVLAVHLLLKEAGCPFTLPVAPLFETL
DDLNNADDVMTQLLNIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKTC
EKAGISLTLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKFGLPEVTI
SSLALYAGAILEANLLPPPEPKKEWVEVMDILSDASCDMYRGYVRENPEFVPYFRAATPE
LELGKLPLGSRPAKRRPNGGVESLRAIPWIFAWTQNRLMLPAWLGAGAGLQKAIDAGKRE
ELATMCRDWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVDKSLWPLGQQLRDQLEADIKV
VLAIANDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQQEHPDARVEQALMVTI
AGVAAGMRNTG
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggaattgaacgcggcgagtggatttgtccatctcagtcttttgggtgaaattaattta
catactcatcaagttacgaagggtactaaaagaaatcatatgaacgaacaatattccgca
atgcgaagtaacgtcagtatgctcggcacgctactcggggacaccatcaaggaagcgctc
ggcgaacacatccttgaaaaagtagaaaccatccgtaaattatctaaatcttcgcgtgct
ggtaatgaagcgagccgtcaggaactgctgacaacgctgcaaaatttatccaatgacgag
ctgctgccggtagcccgcgcttttagtcaatttctcaatttgaccaacacagcggagcaa
tatcacagcatttcgccacatggtgaagccgcaagtaatccggaagccctggcccagcta
ttcacccgtttgaaagacaaaaagctgagcgaaaaagacatgcgcagcgcggttgatgag
ttgtctattgagctggtgttgacggctcacccaaccgaaattactcgccgtaccttgatt
cataaactggtcgaagtgaatacctgcctgagccagctggatcacaatgatttagccgat
tacgaacgcaacaagatcatgcgtcgtttgcggcagttagtcgcacaatcatggcatacc
gacgaaattcgtaaaattcgcccttccccggttgatgaagccaaatggggctttgctgtg
gttgaaaacagcctatgggaaggcgtgcccgctttcctgcgtgagtttaacgagcagttg
caaaactccctcgattaccgcttgccggtagaagccgtgccgatccgcttcacttcatgg
atgggtggcgaccgcgatggtaaccctaatgttactgccgaaattactcgccatgtgctg
ctactgagccgctggaaagccactgatttgttcctgcgtgatattcaggtcttggtatca
gagctttccatgtcggaatgtacgccagaattgcgtgaattggcgggtggcgaagaggtg
ctcgaaccttatcgtgaactgatgaagcgcatgcgcacccagttgacgaacacccagacc
tatctggaaggccgcctgaaaggcgagcgtgtattgccaccgactgatttgctggtcagt
aatgaccaattgtgggacccgctatacgcctgttatcaatcgctaaaaacctgtggcatg
gaaatcatcgccaacggccaattactggataccctgcgtcgcgtgcgctgtttcggtgtg
ccgctggtgcgtattgatgtgcgtcaggaaagtacccgtcataccgatgccattgctgaa
ctgacccgctatttaggtctgggtgattatgaaagctggtctgaagcggacaaacaagcc
tttctgatccgtgagttgaactccaagcgcccattagttccactgaaatgggagccaagt
gccgagactcaagaagtgctggaaacctgccgagtcattgccgaagcaccgcagggttcc
attgctgcttacgtgatttccatggccaaagtgccatcggacgtgctggcagtgcattta
ctgctgaaagaagccggttgcccgttcactctgccagtcgcgccattgttcgaaactctc
gatgacctgaataatgctgacgatgtgatgacccagttactgaatatcgactggtatcgc
ggcctgatccaaggcaagcaaatggtgatgattggctattctgactcagcgaaagatgcc
ggcgtgatggctgcgtcttgggcgcaatatcgcgcgcaggatgctctcatcaaaacctgc
gagaaagctggcatctctctgacactgttccatggccgtggcggttctatcggccgtggt
ggcgcgccagcgcatgctgcactgctttctcagcctcctggcagcctgaaaggcggctta
cgtgtcactgaacaaggcgagatgattcgctttaagtttggtttaccggaagtcactatc
agcagtttggcgctttatgctggtgcgattctggaagctaatttgttgccgccgccggag
ccgaaaaaagagtgggtggaggtgatggatattctgtctgatgcttcctgcgatatgtat
cgtggctatgtacgtgaaaatcctgagtttgtgccttacttccgtgccgcgacgccagaa
ctggaattaggcaaattaccattgggttcacgcccagctaagcgccgtccgaacggcgga
gtagaaagcctgcgtgctattccctggattttcgcctggacgcaaaaccgcctgatgtta
cccgcctggctgggtgccggtgccggtttgcagaaagcgatcgacgccgggaaacgggaa
gagttagccactatgtgccgtgactggccgttcttctcaacccggattggtatgctggaa
atggtgttcgccaaagcagatttgtggctggcagaatattatgaccaacgtctggtagat
aaatcgctgtggccgttaggtcagcaactacgcgaccaactggaagccgatattaaagtg
gtgctggcgattgccaacgatgaccatttgatggcggatctaccgtggattgcggagtct
atcgcgctgcgtaatgtctacaccgacccattaaacgtgctgcaagccgagctactgcac
cgctcgcgccagcaagaacacccagatgcccgcgttgagcaagcattgatggtgactatt
gccggtgtggcggcagggatgcgcaatacaggttag

DBGET integrated database retrieval system