KEGG   Yarrowia lipolytica: YALI0B14883gHelp
Entry
YALI0B14883g      CDS       T01033                                 

Definition
(RefSeq) YALI0B14883p
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
yli  Yarrowia lipolytica
Pathway
yli00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    YALI0B14883g
Enzymes [BR:yli01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     YALI0B14883g
Chromosome [BR:yli03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     YALI0B14883g
   HMT complexes
    COMPASS/SET1 complex
     YALI0B14883g
    COMPASS/SET1 complex (yeast)
     YALI0B14883g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N-SET SET SET_assoc RRM_1
Motif
Other DBs
NCBI-GeneID: 2907346
NCBI-ProteinID: XP_500904
UniProt: Q6CEK8
LinkDB All DBs
Position
B:join(1974509..1975681,1975746..1978085)
Genome map
AA seq 1170 aa AA seqDB search
MANGSDTKPVPKGPRGARADDTRTPPHPDRRGSDRDQYFSKDRSYGGRTDRDYSDYDRAY
PPPRDYDRYGGGKYGKYDKYDKYDRYDRLDSHDYPPRRDRDYDRSRDARDTDSRDYGRLP
PRDTRPPPRGGREYRYARDERGWDRDRRDLDRDRDRDPRDRERDARDRDRDRDFRDRDHD
PRDRDPKGYRPHSLDPLPSRDRDMPPRERERELVRERDLFSRDRDLITGVRELARSPPPP
LRDGRNRDRSNDRHDRSFDKHTRDRGTRDRDTKEKGSVISTPQTAPTPRLTPTNGKPDLP
TSQPPAPPSPPRLKTFPKEVWETVGRKNNTRLTYDPELSKDKQKGKRGIYEEVKKGASTT
EDPRSKHPHYFKTSSKSNKKPYQRLPVPRFLYDANSIAPPPSTQIIVKGLSSLTTSKTIT
AHFKTYGELEAVNMVEDPATGSSVGACLVRFKVTKNNYEAAHECLKKAIRGQKTGRIDQA
KYRVEPDEDGAKAKDIIKRVAARAAKKAMPVKQPPTAPAADKSIMEKLPTPVPSARPSPK
AAQLMKTSAYIFIAGKYLPSEKVFASDIRRILRDFGWFDVLKEGDGFYVFFDNNRDTVEC
YEAMNGRKVNGHQMAMAMIRLSRVAPKTKESEENATEQAPKLPPKEEARKLIVQELANSL
RKDIRERVIAAAIVEFLNPARFTHIKQDPEPSAATEPNTVNASAARVDTPEPVQSSSAIP
GFLPRFKIKRKGDPTKKKDATKKNRKKISARPMNHVLNDYYSDEEDSTRMSTPIVPDTSA
DAAELPIRKPRKKISQSKQRIMDFSSSEGSNESEEEEEVEDDMEEEEDETAQEELQEAST
LDTSQQLTTAFGEILDWAPAHGFPQPVTADKKGGALTTISGFQALVKDDEDMELLQEALE
GIEPEKINGEAWTWTHKHLNEAVAKENAEFPELAAPNAFVNSTGSWKSQGYFKIPEAAKS
EYLPHRKKLNIPIDTLQMENREKKKENASNSRVNRANNRRLVADINMQKQLLSTETDVLN
FNQLRKRKKPVKFARSAIHNWGLYAIEPIAANEMIIEYVGEVVRQEIADLREARYMRSGI
GSSYLFRVDESTVVDATKRGGIARFINHCCTPSCTAKIIKVEGQKRIVIYASRDIAANEE
LTYDYKFEKEIGEERIPCLCGAPGCKGYLN
NT seq 3513 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacggctcagatacaaagcccgtgccgaaggggcctcgtggtgctcgtgcggac
gacactcgaacgcccccacatcccgaccgacggggttcggaccgcgaccaatatttttcc
aaagaccgcagttatggcggccgtacggaccgtgactactcagactatgatcgtgcttac
cccccgccacgggactatgaccggtacggcggtggaaagtacggcaagtatgacaagtac
gacaagtacgatcggtatgaccgcctcgactcacatgactatcctcctcgtcgcgaccgc
gactacgacagatcaagagacgcgcgggacacagattccagagactacggacgtcttcca
cctcgggatactcgcccaccacctcggggaggccgtgagtaccgctacgcgagagacgag
cgtggctgggatagagaccgacgagacctagaccgagatcgagatcgggacccgcgtgac
cgcgaaagagatgcacgtgatcgagacagagatcgggattttcgtgacagagatcatgac
ccacgtgatcgagaccccaagggctaccgaccacattccttggatcctttgccctctcga
gaccgtgatatgcctcccagagagcgagagagagagctagtgcgagaaagagatctgttc
tccagagaccgggatctgattaccggtgttagagagcttgcccgttctccacctcctcca
ctacgtgatggacgaaaccgagaccgctcaaacgacagacacgatagatcttttgacaag
cacaccagagaccgaggcacgagggacagagacaccaaggagaagggatctgtaatctcg
acacctcagactgctccaactccaagattaacccccaccaacggaaaaccggatctgcct
acctctcaaccgccagctcctccttctccaccacggctcaaaaccttccccaaagaagtg
tgggagacagtgggcaggaaaaacaacacaagactaacttacgatcccgagctttccaag
gataaacaaaaaggcaagagaggcatttatgaggaggtcaaaaaaggagcatccacaact
gaggatcctcgaagcaaacatccgcattatttcaagacttccagcaagtccaacaaaaag
ccgtatcagagattaccggtgcccagatttctgtacgacgcaaattctatcgcaccacct
ccatcaactcagatcattgtcaagggtctttcttcactaactacctctaaaactatcact
gcccatttcaagacatatggtgagcttgaagccgtcaacatggtagaggaccctgctaca
ggttcttcagtgggagcatgtctggttcgattcaaggtgacgaaaaacaattacgaggcc
gcccatgagtgcctcaaaaaggccatccgaggccaaaaaacaggacgaattgaccaggcc
aagtacagagtggagccagatgaggatggagccaaggccaaggatatcatcaaaagagtg
gcagctcgagcagctaagaaagccatgcctgtcaagcagcctcctactgcacctgctgca
gacaagtccatcatggagaaactgcccacacctgttccttcagctcggccatctccaaag
gcagcgcagttgatgaaaaccagcgcatacatcttcattgctggtaagtacctaccgtca
gaaaaagtgtttgcatctgatattcgtcggattctgcgtgacttcggctggtttgatgtt
ctcaaggaaggagatggtttctacgttttcttcgacaacaacagggatactgtagaatgt
tacgaggccatgaatggcagaaaggtgaatggccaccagatggctatggctatgattcga
ctttctcgagttgctcccaagaccaaagagagcgaggaaaacgccaccgagcaggccccc
aagctccctcctaaggaagaggcccggaaactcatcgtacaggagttggccaatagtctc
cgtaaggatattcgggagcgggtaattgctgcagccattgtggagtttctgaatccagct
cgatttactcatatcaagcaggatcctgagccatctgccgctactgaacccaacactgtt
aacgccagtgccgctcgagtagatactcccgagcctgtgcaatcgtcttctgcgatccca
ggtttccttcctcggttcaaaatcaagcgaaagggtgatccgaccaagaagaaggatgcc
accaagaagaaccgaaagaagatatctgctcgtcccatgaaccacgttctcaacgactac
tactcggatgaggaagacagcactcgaatgtcgactcccattgtccctgatacctccgct
gacgctgccgaacttcctattagaaaaccccgcaagaagatcagtcagtccaagcagcga
attatggacttcagcagttctgaaggctcgaatgagtccgaggaagaggaggaagtggag
gatgatatggaagaagaagaggacgaaactgcgcaggaggaactccaagaagcatcgact
ctcgatacttcccaacaacttacaactgcattcggcgagattctcgactgggctcctgct
cacggtttccctcaacctgtaacagccgacaaaaagggtggtgctctgactaccatatca
ggtttccaggcgctggttaaggacgacgaagatatggagttgctccaggaggccctggag
ggtattgagcctgaaaagatcaacggagaagcatggacgtggacccataaacatctcaac
gaggctgtagccaaggaaaacgcagagttccccgaactggctgctcccaacgcgtttgtt
aactccactggctcatggaagtctcagggatacttcaagatccctgaggctgccaaatcc
gaatacctgcctcaccgaaagaagctcaacatccccatcgacacgcttcaaatggaaaac
cgagagaaaaagaaggagaacgcctccaactcgcgagttaaccgtgccaacaaccggagg
ctggtggcagacatcaacatgcagaaacagctgctgtccaccgaaaccgatgtgctcaac
ttcaatcagctgcgaaagcgaaagaagcctgtcaagttcgctcgttcagctatccacaac
tggggtctctatgctattgagcccattgcagccaacgagatgatcatcgagtacgtcgga
gaagttgtgcgacaggagattgccgacttgcgagaagctcggtacatgaggtcaggtatc
ggatcttcatatctgttcagagttgatgaaagcactgtcgtggacgccacaaagcgagga
ggtattgctcggttcatcaaccattgctgtacccccagctgcacggccaaaatcatcaag
gtggagggtcaaaaacgtatcgtcatctatgcctcgcgggacattgctgccaacgaggag
ctcacatatgactacaagttcgaaaaggagattggagaagagaggattccctgtctgtgt
ggcgcacctggctgcaagggatacctcaattga

DBGET integrated database retrieval system