KEGG   Yersinia pseudotuberculosis PA3606: BZ19_1438Help
Entry
BZ19_1438         CDS       T03846                                 

Definition
(GenBank) aldose 1-epimerase family protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ypf  Yersinia pseudotuberculosis PA3606
Pathway
ypf00010  Glycolysis / Gluconeogenesis
ypf01100  Metabolic pathways
ypf01110  Biosynthesis of secondary metabolites
ypf01120  Microbial metabolism in diverse environments
ypf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BZ19_1438
Enzymes [BR:ypf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     BZ19_1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AJK14517
LinkDB All DBs
Position
complement(1591571..1592446)
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPVVVVSHPKVRAAISLQGAHLLAYQPSGEQPIIW
LSNNTPFKEGIAIRGGVPICWPWFGPTAQPAHGFARILPWTLSAHDENENGVILTFTLED
NDMTRQYWPHAFTLIARFKLGDECEVELESHGDYQAAAALHTYFQIGDISQIKVSGLGEK
YLDKVLKVADVTQQGDLVFNGQTDRVYTQPEAYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSCSMVDMPNDGYKTMVCVETARVNKPLVAAPDAPARLAMTIRSRKNT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtatttactctccctgttgttgaacaaatttctccttatatcagccag
cgtcaactggatgaattgccggtagtggttgtttctcatcctaaggtgcgtgcggcaata
agtttgcagggggcccacttactggcctatcaacccagtggtgagcaacccattatctgg
ctgagcaataacacgccttttaaagaaggtattgcgattcgtggaggggttccaatttgt
tggccttggtttggcccaaccgcacaacctgcccatggttttgcccgcatcttgccatgg
acgctcagtgctcatgatgaaaatgaaaacggcgtcattctgactttcacccttgaagac
aacgacatgacccgccaatactggccacatgccttcaccctgatcgcccgtttcaagttg
ggagatgaatgtgaagttgaactggaatcacacggtgattatcaggctgctgcggcatta
catacctacttccagattggcgatataagccaaattaaagtcagcgggctgggtgagaaa
tatttagataaagtgctgaaagttgccgatgtcactcaacaaggcgatttagtctttaac
ggccaaactgaccgtgtctatacccaacctgaagcctatagtctgataaaagatgccgcg
ctgaaacgaactattgaggtccatcaccatcaccaaagtgatgtggttgcctggaacccc
ggcgctgaattgtcctgcagcatggtagatatgccaaatgatggctataaaacgatggtt
tgcgtagaaaccgcacgagtcaacaagccattggtggctgcgcctgatgcaccagcacgt
ttggcgatgaccatccgtagccgtaaaaacacctaa

DBGET integrated database retrieval system