KEGG   Yersinia pestis biovar Medievalis Harbin 35: YPC_4435Help
Entry
YPC_4435          CDS       T01874                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yph  Yersinia pestis biovar Medievalis Harbin 35
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yph00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPC_4435
Enzymes [BR:yph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YPC_4435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4296920..4298518
Genome map
AA seq 532 aa AA seqDB search
MAYLLVFDYNRERKRTLKRCFEHSEEGNMETKDLIVIGGGINGAGIAADAAGRGLSVLLL
EAQDLACATSSASSKLIHGGLRYLEHYEFRLVSEALAEREVLLKLAPHIAFPMRFRLPHQ
PHLRPAWMIRTGLFLYDHLGKRTSLPASKGLRFGPESVLKPELVRGFEYSDCWVDDARLV
VLNAQEVVKHGGEVRTRTKVTRAWREQGLWMVEALDVNTGKTFTWRAKGLVNATGPWVKQ
FFDDGLKLKSPYGIRLIKGSHIVVPRVHNQPQAYILQNEDHRIVFVIPWLDDYSIIGTTD
VEYHGDPKEVKIDDQEMTYLLKVYNDHFKKQLGRDDIVWTYSGVRPLCDDESDSPQAVTR
DYTLDVADEAGQAPLLSVFGGKLTTYRKLAEHALEKLSAYYPNVGPAWTKTGALPGGDIG
GSRDSYTVQLRHRYNWLPEGLARRYTRTYGSHSELILANATRLESLGEHFGHGLYEAELR
YLVENEWVVELDDAIWRRTKLGMALSDEEKQRVAQWLADAHTEKQQALPLVS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
ttggcttatttgttggtttttgattacaatcgtgagcgaaaacgaacattaaagcgctgt
ttcgaacattcagaggaaggtaacatggaaaccaaagacttgatcgtgatcggtggcggt
attaacggtgccggtatcgctgcggacgctgctgggcgtggcctgtcggtactgctgctg
gaagcgcaagacttggcctgtgctacgtcttccgccagttccaaacttatccatggtggc
ttacgctatctggaacattatgaattccgcttggtaagtgaagccttggccgagcgtgaa
gtgttactgaaactggcaccgcatatcgcattccctatgcgcttccgcctaccccaccag
cctcatctacgcccggcatggatgatccgcaccggcttgttcttgtatgaccatttgggc
aaacgtaccagcctgcctgccagtaaagggctgcgttttgggccggaatctgtgttaaag
cccgagttggtgcgcggtttcgaatattctgactgttgggtggatgatgcccgcctggtg
gtgctgaatgcgcaggaagtggttaaacacggcggtgaagtccgaacccgtaccaaagtg
acccgcgcatggcgtgaacaaggcctatggatggttgaagcccttgatgtcaataccggc
aaaaccttcacctggcgggctaaaggcttagtgaatgccactggcccttgggttaaacag
ttcttcgacgatggcctaaagctcaaatcaccttatggcatccgcctaattaaaggcagc
cacattgtggtgcctcgggttcataaccaaccgcaggcgtatattctgcaaaatgaagat
caccgtatcgttttcgttatcccttggttagatgactattccatcatcggtactaccgac
gtggaataccacggcgatccaaaagaggtgaaaattgacgatcaggaaatgacttatctg
ctgaaagtctataacgaccactttaaaaaacagttgggtcgtgacgatatcgtctggacc
tactctggtgtgcgcccgctatgcgacgatgaatcagattcaccgcaagccgttacccgc
gattacacgctagatgtggccgatgaagcgggtcaggcaccactgctgtcggtcttcggc
ggtaagctcaccacgtaccgtaaattggcagaacatgcgctggaaaaactgtcagcgtac
tacccgaatgtcggcccagcgtggactaaaaccggtgccttgcccggtggggatatcggc
ggtagtcgtgatagctataccgtgcaattacgccaccgctataactggttgccggaaggg
ttagcccgccgctatacccgtacctatggtagccacagcgagctaattttagccaacgcg
acccgtcttgaaagcctaggtgagcactttggtcacggcttgtatgaggctgaattgcgc
tatttggttgagaacgagtgggtcgttgagctggatgatgctatctggcgtcgtaccaaa
ttaggcatggccctcagcgatgaagagaaacagcgggtagcccagtggctggctgatgcg
cacactgaaaaacaacaggcgctgccgctggtttcttaa

DBGET integrated database retrieval system