KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_3867Help
Entry
YpsIP31758_3867   CDS       T00570                                 

Gene name
tuf2
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Brite
Translation factors [BR:ypi03012]
 Eukaryotic Type
  Elongation factors
   YpsIP31758_3867 (tuf2)
 Prokaryotic Type
   YpsIP31758_3867 (tuf2)
Mitochondrial biogenesis [BR:ypi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    YpsIP31758_3867 (tuf2)
Exosome [BR:ypi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YpsIP31758_3867 (tuf2)
  Exosomal proteins of breast cancer cells
   YpsIP31758_3867 (tuf2)
  Exosomal proteins of colorectal cancer cells
   YpsIP31758_3867 (tuf2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4358205..4359389)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GDAEWEAKIIELAEALDSYIPQPERAIDRPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIIDTIKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDDVQRGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNVNMV
VNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaagccgcacgttaatgtgggtactattggccac
gttgaccatggtaaaactaccttaactgctgcaatcaccaccgtattggctaaaacctac
ggcggtagtgctcgtgcattcgaccagatcgacaacgctccggaagaaaaagcgcgtggt
atcaccatcaacacttctcacgttgaatatgatactcctgctcgtcactatgcacacgtt
gactgcccaggtcatgctgactacgttaaaaatatgatcaccggtgctgctcagatggat
ggagcgatcttggttgttgctgcaaccgatggccctatgccgcagactcgtgagcatatc
ctgctgggccgccaggttggtgtcccatacattattgtcttcctgaacaaatgtgacatg
gttgacgatgaagagttgctagagttggttgaaatggaggttcgtgagcttctgtctcaa
tacgatttcccaggcgacgacactccagtcatccgtggttcagcgttgaaagccctggaa
ggtgacgctgagtgggaagctaaaattatcgaattggcagaagctctggatagctatatt
ccgcaaccagaacgcgctattgatagaccattcctattgccaattgaagacgtattctct
atttctggtcgtggtactgtagttactggtcgtgtagaacgcggtattgttaaggtcggc
gaagaagttgaaatcgttggtattatcgatacgattaaaacaacttgtactggcgttgaa
atgttccgcaagctgctggatgaaggccgtgctggtgaaaatgttggtgttctgctgcgt
ggtactaagcgtgacgatgttcagcgtggtcaagtactggcgaaaccaggttctatcaag
ccacacacgaagtttgagtcagaagtttatattctgagcaaagatgaaggcggccgtcat
acaccgttcttcaagggctaccgtcctcagttctacttccgtacaactgacgtgaccggt
accattgagctgccagaaggcgttgaaatggtcatgcctggtgacaacgtaaacatggtt
gttaacctaattgctcctatcgcaatggatgatggtctgcgcttcgcaattcgtgagggt
ggccgtactgttggtgctggcgttgttgctaaagtcattgaataa

DBGET integrated database retrieval system