KEGG   Yersinia pseudotuberculosis IP 31758 (serotype O 1b): YpsIP31758_4000Help
Entry
YpsIP31758_4000   CDS       T00570                                 

Gene name
glpD
Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypi  Yersinia pseudotuberculosis IP 31758 (serotype O:1b)
Pathway
ypi00564  Glycerophospholipid metabolism
ypi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YpsIP31758_4000 (glpD)
Enzymes [BR:ypi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YpsIP31758_4000 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABS46612
UniProt: A0A0U1QVR8
LinkDB All DBs
Position
4488734..4490248
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVKHGGEVRTRTKVTRAWREQG
LWMVEALDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGDPKEVKIDDQEMTYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEAGQAPLLSVFGGKLTTYRK
LAEHALEKLSAYYPNVGPAWTKTGALPGGDIGGSRDSYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILANATRLESLGEHFGHGLYEAELRYLVENEWVVELDDAIWRRTKLGMALSDE
EKQRVAQWLADAHTEKQQALPLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggtattaacggtgccggtatcgctgcg
gacgctgctgggcgtggcctgtcggtactgctgctggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaacttatccatggtggcttacgctatctggaacattatgaa
ttccgcttggtaagtgaagccttggccgagcgtgaagtgttactgaaactggcaccgcat
atcgcattccctatgcgcttccgcctaccccaccagcctcatctgcgcccggcatggatg
atccgcaccggcttgttcttgtatgaccatttgggcaaacgtaccagcctgccagccagt
aaagggctgcgttttgggccggaatctgtgttaaaacccgagttggtgcgcggtttcgaa
tattctgactgttgggtggatgatgcccgcctggtggtgctgaatgcgcaggaagtggtt
aaacacggtggtgaagtccgtacccgtaccaaagtgacccgtgcctggcgtgaacaaggc
ctatggatggttgaagcccttgatgtcaataccggcaaaaccttcacctggcgggctaaa
ggcttagtgaatgccactggcccttgggttaaacagttcttcgacgatggcctaaagctc
aaatcaccttatggcatccgcctaattaaaggcagccacattgtggtgccccgggttcat
aaccaaccgcaggcgtatattctgcaaaatgaagatcaccgtatcgttttcgttatccct
tggttagatgactattccatcatcggtactaccgacgtggaataccacggcgatccaaaa
gaggtgaaaattgacgatcaggaaatgacttatctgctgaaagtctataacgaccacttt
aaaaaacagttgggtcgtgacgatatcgtctggacctactctggtgtgcgcccgctatgc
gacgatgaatcagattcaccgcaagccgttacccgcgattacacgctagatgtggccgat
gaagcgggtcaggcaccactcctgtcggtcttcggcggtaaactcaccacctaccgtaaa
ttggcagaacatgcgctggaaaaactgtcagcgtactacccgaatgtcggcccagcgtgg
actaaaaccggtgccttgcccggtggggatatcggcggtagtcgtgatagctataccgtg
caattgcgccaccgctataactggttgccggaagggttggcccgccgctatacccgtacc
tatggtagccacagcgagctaattttagccaatgcgacccgtcttgaaagcctgggtgag
cactttggtcacggcttgtatgaggctgaattgcgctatttggttgagaacgagtgggtc
gttgagctggatgatgctatctggcgccgtaccaaattaggcatggccctcagcgatgaa
gagaaacagcgggtagcccagtggctggctgatgcgcacactgaaaaacaacaggcgctg
ccgctggtttcttaa

DBGET integrated database retrieval system