KEGG   Yersinia pseudotuberculosis MD67: BZ21_2114Help
Entry
BZ21_2114         CDS       T03677                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ypu  Yersinia pseudotuberculosis MD67
Pathway
ypu00250  Alanine, aspartate and glutamate metabolism
ypu00410  beta-Alanine metabolism
ypu00640  Propanoate metabolism
ypu00650  Butanoate metabolism
ypu01100  Metabolic pathways
ypu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ypu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BZ21_2114 (gabT)
   00650 Butanoate metabolism
    BZ21_2114 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BZ21_2114 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BZ21_2114 (gabT)
Enzymes [BR:ypu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BZ21_2114 (gabT)
Amino acid related enzymes [BR:ypu01007]
 Aminotransferase (transaminase)
  Class III
   BZ21_2114 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJJ03511
LinkDB All DBs
Position
complement(2348667..2349956)
Genome map
AA seq 429 aa AA seqDB search
MSHRELEQRRKEATPRGIGVLCDFYAVRAENATLWDEQGREYIDFTAGIATLNIGHRHPK
VMAAVRQQLDQFTHTAYQVVPYASYVTLAEKINSLAPISDSNMTAAGNSKTAFFTTGVEA
IENAVKIARAATGRPGVIAFSGAFHGRTLLAMALTGRAVPYKVGFGPFPASIFHALYPNE
LYGVSVEEAISSVERLFRCDISPTQVAAILFEPIQGEGGFNIAPPEFVSALRTLCDEHGI
LLIADEVQTGFARTGKLFAMEYYPDTKVDVITMAKSLGGGMPISAVTGRADIMDAPLPGS
LGGTYAGNPLAVAASLVVLDIIAEEKLCERALILGAKLVDVLEKAQMSNAAIVGIRARGS
MVAVEFNDPVSGKPSPELTRAYQRQALEEGLLLLSCGVHSNVIRFLYPLTIPDKQFKQAM
NILTRLLAS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaccgtgaattggaacaacgcagaaaagaggcgaccccacgtgggattggtgtg
ttatgtgatttctatgcggtacgggctgaaaatgccacgctgtgggatgaacaggggcgg
gaatatatcgattttacggcgggtattgcgacactcaatatcggacaccgccacccgaaa
gtgatggccgctgtgcgccaacaactggaccagtttacccatactgcctatcaggtggtg
ccttacgccagttatgtcacattggcagagaaaattaattcgctagcccctatttctgat
tcaaatatgacggcagcgggcaacagtaaaaccgcttttttcaccactggggtcgaagcg
atagaaaatgccgtgaaaatagcgcgtgcggcgactggccgccctggtgtgattgctttc
tccggggcatttcatggccgaaccttattggcgatggcgctgaccggtagagcggtgccg
tacaaagtcggttttggcccgttccctgcctccatttttcacgccctctatcccaatgag
ttgtatggcgtgagtgttgaagaggccatcagcagtgttgagcgcctgtttcgttgtgat
atcagtccgacacaagtggcggccattctatttgagccgattcagggcgagggtggtttt
aatatcgccccgccggaatttgtcagtgctttgcgcaccctgtgtgatgagcacggtatt
ttgctgattgccgatgaagtacaaacggggtttgcccgtacaggcaagttatttgccatg
gaatattatcccgacaccaaagttgatgtgatcaccatggcgaaaagccttgggggcggt
atgccaatttccgcggtcacggggcgggccgacattatggatgccccgttgccggggagt
ttgggcggtacttatgccggtaacccactggcggtggctgcgtcactggtggtgctcgat
attattgcggaagagaagttatgcgagcgcgccctgattttaggcgcgaagttggtcgac
gtactggaaaaagcccaaatgagcaatgcggccattgtgggcattcgtgcgcgtggatcc
atggtggcggtggaatttaacgatcccgtcagcggtaaaccgtcaccagaactgacgcgc
gcctatcaacgtcaggcactggaagaggggctgttactcctgagttgcggtgtccacagc
aacgtgatccgcttcctctacccattgaccattcccgacaagcaatttaaacaggcgatg
aatattcttacccgcctactggcgagctaa

DBGET integrated database retrieval system