KEGG   Yersinia pestis Z176003: YPZ3_2221Help
Entry
YPZ3_2221         CDS       T01210                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ypz  Yersinia pestis Z176003
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypz00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    YPZ3_2221
Enzymes [BR:ypz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     YPZ3_2221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2877803..2879317)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKLAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVKHGGEVRTRTKVTRTWREQG
LWMVEALDVNTGKTFTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDDYSIIGTTDVEYHGDPKEVKIDDQEMTYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADEAGQAPLLSVFGGKLTTYRK
LAEHALEKLSAYYPNVGPAWTKTGALPGGDIGGSRDSYTVQLRHRYNWLPEGLARRYTRT
YGSHSELILANATRLESLGEHFGHGLYEAELRYLVENEWVVELDDAIWRRTKLGMALSDE
EKQRVAQWLADAHTEKQQALPLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgtgatcggtggcggtattaacggtgccggtatcgctgcg
gacgctgctgggcgtggcctgtcggtactgctgctggaagcgcaagacttggcctgtgct
acgtcttccgccagttccaaacttatccatggtggcttacgctatctggaacattatgaa
ttccgcttggtaagtgaagccttggccgagcgtgaagtgttactgaaactggcaccgcat
atcgcattccctatgcgcttccgcctaccccaccagcctcatctacgcccggcatggatg
atccgcaccggcttgttcttgtatgaccatttgggcaaacgtaccagcctgcctgccagt
aaagggctgcgttttgggccggaatctgtgttaaagcccgagttggtgcgcggtttcgaa
tattctgactgttgggtggatgatgcccgcctggtggtgctgaatgcgcaggaagtggtt
aaacacggcggtgaagtccgaacccgtaccaaagtgacccgcacatggcgtgaacaaggc
ctatggatggttgaagcccttgatgtcaataccggcaaaaccttcacctggcgggctaaa
ggcttagtgaatgccactggcccttgggttaaacagttcttcgacgatggcctaaagctc
aaatcaccttatggcatccgcctaattaaaggcagccacattgtggtgcctcgggttcat
aaccaaccgcaggcgtatattctgcaaaatgaagatcaccgtatcgttttcgttatccct
tggttagatgactattccatcatcggtactaccgacgtggaataccacggcgatccaaaa
gaggtgaaaattgacgatcaggaaatgacttatctgctgaaagtctataacgaccacttt
aaaaaacagttgggtcgtgacgatatcgtctggacctactctggtgtgcgcccgctatgc
gacgatgaatcagattcaccgcaagccgttacccgcgattacacgctagatgtggccgat
gaagcgggtcaggcaccactgctgtcggtcttcggcggtaagctcaccacgtaccgtaaa
ttggcagaacatgcgctggaaaaactgtcagcgtactacccgaatgtcggcccagcgtgg
actaaaaccggtgccttgcccggtggggatatcggcggtagtcgtgatagctataccgtg
caattacgccaccgctataactggttgccggaagggttagcccgccgctatacccgtacc
tatggtagccacagcgagctaattttagccaacgcgacccgtcttgaaagcctaggtgag
cactttggtcacggcttgtatgaggctgaattgcgctatttggttgagaacgagtgggtc
gttgagctggatgatgctatctggcgtcgtaccaaattaggcatggccctcagcgatgaa
gagaaacagcgggtagcccagtggctggctgatgcgcacactgaaaaacaacaggcgctg
ccgctggtttcttaa

DBGET integrated database retrieval system