KEGG   Yersinia ruckeri Big Creek 74: UGYR_03340Help
Entry
UGYR_03340        CDS       T03887                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
yrb  Yersinia ruckeri Big Creek 74
Pathway
yrb00250  Alanine, aspartate and glutamate metabolism
yrb00410  beta-Alanine metabolism
yrb00430  Taurine and hypotaurine metabolism
yrb00650  Butanoate metabolism
yrb01100  Metabolic pathways
yrb01110  Biosynthesis of secondary metabolites
yrb01120  Microbial metabolism in diverse environments
yrb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:yrb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    UGYR_03340
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UGYR_03340
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UGYR_03340
   00430 Taurine and hypotaurine metabolism
    UGYR_03340
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    UGYR_03340
Enzymes [BR:yrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     UGYR_03340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AKA37526
UniProt: A0A085UBP8
LinkDB All DBs
Position
727703..729106
Genome map
AA seq 467 aa AA seqDB search
MTKKNDTNDFRSTLLDSRFGSESIRHIAESKRFPEKEIREDVAFQIINDELFLDGNARQN
LATFCQTWDDDNVHKLMDLSINKNWIDKEEYPQSAAIDMRCVNMVADLWNAPKQKNGQAV
GTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTNKPNFVCGPVQVCWHKFARYWDVEIRE
LPMEPGQLFMDPQRMIEACDENTIGVVPTFGVTYTGNYEFPKPLHDALDKLQRETGLDID
MHIDAASGGFLAPFVAPDIEWDFRLPRVKSISTSGHKFGLAPLGCGWVIWRDEASLPEEL
VFKVDYLGGQVGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQSASYQVAAFLAEEIAK
LGSYEFICSGGVEEGIPAVCFRVKEGAKPGYTLYDLSERLRLRGWQVPAFALNGGMSDVV
VMRIMCRRGFEMDFAELLLEDFKSSLNYLSQHPSLGGLASQNSFKHT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaaatgataccaatgattttcgctcaacacttctagactctcgcttcggt
tctgaatctattcgtcatatagctgaaagcaaacgtttccctgaaaaagagatacgcgaa
gatgtggcttttcaaattatcaatgacgaattatttctcgacggaaatgcacggcagaac
ttagcgacgttttgccaaacgtgggatgacgataacgtgcataagctgatggatctctca
atcaataaaaactggattgataaagaggaatatcctcagtctgcagccattgatatgcgc
tgtgtcaatatggtcgccgatctgtggaatgcaccaaagcagaaaaatggtcaggccgtt
ggtactaacaccatcgggtcttcagaagcctgcatgctcggtggaatggcgatgaaatgg
cgttggcgtaaacgcatggaagccgctggtaaaccgaccaataagccaaactttgtttgt
ggccctgttcaggtttgctggcataaatttgcacgctattgggacgtcgaaatacgtgaa
cttccaatggagccaggccaactatttatggatcctcagcgaatgattgaggcttgtgat
gaaaataccatcggggtagtaccaacctttggtgtaacttacacgggtaattatgagttt
cctaaaccacttcatgatgcgttagacaaattgcaacgcgagacgggtttagacattgat
atgcatatcgatgcagccagtggtggctttttggcaccttttgttgccccggatatcgaa
tgggacttccgtttaccgcgcgtgaagtctatcagtacttcaggccacaagtttggtctg
gcacctctgggctgcggttgggttatttggcgtgatgaagcatcactacctgaagagttg
gtattcaaggtcgattatctgggtggacaggtggggacattcgctatcaatttttctcgt
ccagcgggacaagttatcgctcaatattatgagtttttacgcttgggtcgtgaaggttat
accaaagtacaaagtgcctcttatcaggttgccgccttcttggcagaagaaattgccaaa
ttaggttcttatgaatttatctgttccggtggtgtcgaggaaggtattcctgcggtttgc
ttccgcgtaaaagaaggcgcaaaacctggttacaccttgtatgacctatctgaacgttta
agactgcgcggttggcaagtacccgcgtttgccctaaacggcggaatgtctgatgtcgta
gtgatgcgtattatgtgccgacgtggcttcgaaatggactttgccgaattattattagaa
gactttaaatcctcgctgaactacttaagccagcacccatcgctgggtggattggcgagc
caaaatagttttaaacatacataa

DBGET integrated database retrieval system