KEGG   Yersinia rohdei: CH64_698Help
Entry
CH64_698          CDS       T03610                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase Fe
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
yro  Yersinia rohdei
Brite
Enzymes [BR:yro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CH64_698 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
777791..778369
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVVNLNNLIKDTEFAGKTLEEIIKTS
SGGIFNNAAQVWNHTFYWHCLSPNGGGEPTGKVAEVINKSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGTLAIVSTSNAATPLTTQDKPLLTVDVWEHAYYIDYRNARPKYLENFWA
LVNWSFVEKNLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattacctgccttaccttatgcgcaaaatgcgctggaaccacacatctct
gctgaaacactggaataccattacggcaagcatcacaacacctatgtggtaaacctcaat
aatctgattaaagacactgagtttgccggtaagacgttggaagaaataataaagacgtct
agcggtggcatctttaacaatgcggcacaggtctggaatcacaccttttactggcattgt
ctgtcccccaatggcggtggcgaacctaccggcaaagtggccgaggtcatcaataaatct
tttggctcttttgccgaatttaaagcgcagtttaccgatgccgcagtaaaaaactttggt
gcaggctggacgtggctggtaaaaaaagcggatggcacactggcaatcgtcagcacatca
aatgcggcgacccccttaaccacccaagataagccgttattaacggtggatgtctgggag
catgcttattatattgattatcgtaatgcgcgaccaaaatacctggagaacttctgggca
ctggttaactggtcttttgttgagaagaatttagcctga

DBGET integrated database retrieval system